DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and Rptor

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_083174.2 Gene:Rptor / 74370 MGIID:1921620 Length:1335 Species:Mus musculus


Alignment Length:579 Identity:101/579 - (17%)
Similarity:169/579 - (29%) Gaps:249/579 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 DLVVDVANEM---ESHSPRPNGEHVSMEVRDRESLNGERLEKPSSSGIKQER----PPSRSGSSS 302
            ||.:.|.|.:   .:.:.||      ..:.|..||.......|::.|:...:    ||:.|.||.
Mouse   828 DLAMKVLNSIAYKATVNARP------QRILDTSSLTQSAPASPTNKGMHMHQVGGSPPASSTSSC 886

  Fly   303 SRSTPSLK---TKDM--EKPGTPGAKARTPTPNA-AAPAPGVNPKQMMPQGP--------PPAGY 353
            |.:....|   ::|:  .:|||.|......||:: ..|    ..::|..:||        ..||:
Mouse   887 SLTNDVAKQTVSRDLPSSRPGTAGPTGAQYTPHSHQFP----RTRKMFDKGPDQTTDDADDAAGH 947

  Fly   354 PG---APYQRP---------ADPYQRPPSDPAYGRPPPMPYDPHAHVRTN--------------- 391
            ..   |..|..         |.|..:.|.:          :|..:.:|..               
Mouse   948 KSFICASMQTGFCDWSARYFAQPVMKIPEE----------HDLESQIRKEREWRFLRNTRVRKQA 1002

  Fly   392 ---------------------GIPHPSALTGGKPAYSFHMNGEGSLQPVPFPPDALVG------- 428
                                 |:|         ....||          ||.|...|.       
Mouse  1003 QQVIQKGITRLDDQIFLNRNPGVP---------SVVKFH----------PFTPCIAVADKDSICF 1048

  Fly   429 -------------VGIPRHARQINTLSHGEVVCAVTISNPTKYVYTGGKGC-----------VKV 469
                         .|.||:.|                  .|...|..|:.|           ::|
Mouse  1049 WDWEKGEKLDYFHNGNPRYTR------------------VTAMEYLNGQDCSLLLTATDDGAIRV 1095

  Fly   470 WDISQPGNKNP--VSQLDCLQRDNYIRSVKLLPDGR-------------TLIVGGEASNLSIWDL 519
            |.......|||  |:....|.        .:||..|             .|:..|:...:.|||.
Mouse  1096 WKNFADLEKNPEMVTAWQGLS--------DMLPTTRGAGMVVDWEQETGLLMSSGDVRIVRIWDT 1152

  Fly   520 ASPTPRIKAELTSAAPACYALAISPDS--KVCFSCCSDGNIAVWDLH---NEILVRQFQGHT--- 576
            ...| ::: ::.:.|.:| ..::|.||  .:..:...||:|.|:|..   :|..|..::.||   
Mouse  1153 DRET-KVQ-DIPTGADSC-VTSLSCDSHRSLIVAGLGDGSIRVYDRRMALSECRVMTYREHTAWV 1214

  Fly   577 ---------------------------------------DGASCIDISPDGSRLWTGGLD----- 597
                                                   .|.:.:||.|..:.:..|.::     
Mouse  1215 VKAYLQKHPEGHIVSVSVNGDVRFFDPRMPESVNVMQIVKGLTALDIHPQANLIACGSMNQFTAI 1279

  Fly   598 --------NTVRSWDLREGRQLQQHDFSSQIFSLGYCPTGDWLAVGMENSHVEVLHASK 648
                    |.::.:|...|:::      ..|..|.:.|....||||..:.::.|....|
Mouse  1280 YNGNGELINNIKYYDGFMGQRV------GAISCLAFHPHWPHLAVGSNDYYISVYSVEK 1332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 51/293 (17%)
WD40 repeat 447..486 CDD:293791 10/51 (20%)
WD40 repeat 494..532 CDD:293791 9/50 (18%)
WD40 repeat 537..573 CDD:293791 11/40 (28%)
WD40 repeat 580..615 CDD:293791 7/47 (15%)
WD40 repeat 620..653 CDD:293791 9/29 (31%)
WD40 repeat 661..695 CDD:293791
WD40 repeat 702..726 CDD:293791
RptorNP_083174.2 Raptor_N 60..206 CDD:291222
HEAT repeat 516..544 CDD:293787
HEAT repeat 557..587 CDD:293787
HEAT_2 566..668 CDD:290374
HEAT repeat 599..625 CDD:293787
ARM <602..671 CDD:237987
HEAT repeat 640..670 CDD:293787
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 749..771
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 853..942 22/92 (24%)
WD40 <1019..1332 CDD:225201 62/366 (17%)
WD 1 1020..1061 8/59 (14%)
WD40 1027..1322 CDD:295369 59/339 (17%)
WD40 repeat 1027..1063 CDD:293791 6/45 (13%)
WD 2 1065..1106 10/58 (17%)
WD40 repeat 1069..1121 CDD:293791 13/77 (17%)
WD 3 1121..1160 7/40 (18%)
WD40 repeat 1126..1162 CDD:293791 6/37 (16%)
WD 4 1164..1203 11/39 (28%)
WD40 repeat 1170..1207 CDD:293791 10/36 (28%)
WD 5 1209..1249 2/39 (5%)
WD 6 1251..1291 6/39 (15%)
WD40 repeat 1256..1297 CDD:293791 6/40 (15%)
WD 7 1299..1335 9/40 (23%)
WD40 repeat 1304..1328 CDD:293791 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.