| Sequence 1: | NP_996298.1 | Gene: | gro / 43162 | FlyBaseID: | FBgn0001139 | Length: | 730 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001132938.1 | Gene: | TBL1X / 6907 | HGNCID: | 11585 | Length: | 577 | Species: | Homo sapiens |
| Alignment Length: | 274 | Identity: | 71/274 - (25%) |
|---|---|---|---|
| Similarity: | 116/274 - (42%) | Gaps: | 49/274 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 465 GCVKVWDISQPGN--------KNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLAS 521
Fly 522 PTPRIKAELT-SAAPACYALAISPDSKVCF-SCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDI 584
Fly 585 SPDGSRLWTGGLDNTVRSWDLREG---RQLQQHDFSSQIFSLGYCPTGDWLAVGMENSHVEVLHA 646
Fly 647 SKPDKYQL---------HL---HESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKET 699
Fly 700 SSVLS-CDISTDDK 712 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| gro | NP_996298.1 | TLE_N | 11..124 | CDD:397828 | |
| WD40 | 442..727 | CDD:238121 | 71/274 (26%) | ||
| WD40 repeat | 447..486 | CDD:293791 | 7/28 (25%) | ||
| WD40 repeat | 494..532 | CDD:293791 | 8/38 (21%) | ||
| WD40 repeat | 537..573 | CDD:293791 | 10/36 (28%) | ||
| WD40 repeat | 580..615 | CDD:293791 | 9/37 (24%) | ||
| WD40 repeat | 620..653 | CDD:293791 | 9/32 (28%) | ||
| WD40 repeat | 661..695 | CDD:293791 | 10/33 (30%) | ||
| WD40 repeat | 702..726 | CDD:293791 | 3/12 (25%) | ||
| TBL1X | NP_001132938.1 | LisH | 57..83 | CDD:285685 | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 177..202 | ||||
| WD40 | 215..577 | CDD:225201 | 71/274 (26%) | ||
| WD40 | 227..533 | CDD:238121 | 64/245 (26%) | ||
| WD 1 | 230..269 | ||||
| WD40 repeat | 235..282 | CDD:293791 | |||
| WD 2 | 286..325 | 4/16 (25%) | |||
| WD40 repeat | 292..327 | CDD:293791 | 4/18 (22%) | ||
| WD 3 | 327..366 | 14/52 (27%) | |||
| WD40 repeat | 332..368 | CDD:293791 | 12/49 (24%) | ||
| WD 4 | 369..409 | 12/42 (29%) | |||
| WD40 repeat | 375..409 | CDD:293791 | 9/33 (27%) | ||
| WD 5 | 410..449 | 10/38 (26%) | |||
| WD40 repeat | 415..451 | CDD:293791 | 7/35 (20%) | ||
| WD 6 | 452..500 | 11/51 (22%) | |||
| WD40 repeat | 457..502 | CDD:293791 | 11/46 (24%) | ||
| WD 7 | 503..542 | 11/38 (29%) | |||
| WD40 repeat | 508..532 | CDD:293791 | 7/23 (30%) | ||
| WD 8 | 544..576 | 4/17 (24%) | |||
| WD40 repeat | 549..572 | CDD:293791 | 3/12 (25%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||