DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and COP1

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:XP_016857548.1 Gene:COP1 / 64326 HGNCID:17440 Length:775 Species:Homo sapiens


Alignment Length:485 Identity:101/485 - (20%)
Similarity:171/485 - (35%) Gaps:146/485 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 SKRRKDEKLQEDEGEKSDQDLVVDVANEMES-HSP-----------RPNGEHVSMEVRD---RES 275
            ::|.|.|:|::.:.|.|..:..:....||.. :||           .|:..| |:|...   |..
Human   271 ARRNKREQLEQIQKELSVLEEDIKRVEEMSGLYSPVSEDSTVPQFEAPSPSH-SLEFSSDMHRIF 334

  Fly   276 LNGERLEKPSSSGIKQERPPSRSGSSSSRSTP-------------SLKTKDMEKPGTPGAKARTP 327
            :||..:.....| .:..:||..||||.::..|             :...:|:|:.......:|..
Human   335 VNGILIISIIDS-TEYSQPPGFSGSSQTKKQPWYNSTLASRRKRLTAHFEDLEQCYFSTRMSRIS 398

  Fly   328 TPNAAAPAPGVNPKQMMPQGPPPAGYPGAPYQRPADPYQRPPSDPAYGRPPPMPYDPHAHVRTNG 392
            ..:..|       .|:                   |.:|...|               ...|.|.
Human   399 DDSRTA-------SQL-------------------DEFQECLS---------------KFTRYNS 422

  Fly   393 IPHPSALTGGKPAYSFHMNGEGSLQPVPFPPD----ALVGVGIPRHARQINTLSHGEVV-CAVTI 452
            :...:.|:.....|    ||...:..:.|..|    |:.||     .::|....:..|: .||.|
Human   423 VRPLATLSYASDLY----NGSSIVSSIEFDRDCDYFAIAGV-----TKKIKVYEYDTVIQDAVDI 478

  Fly   453 SNPTKYVYTGGK--------------------GCVKVWDISQPGNKNPVSQLDCLQRDNYIRSVK 497
            ..|...:....|                    |.|.:|| ...|.::.|.|    :.:....||.
Human   479 HYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWD-GFTGQRSKVYQ----EHEKRCWSVD 538

  Fly   498 L-LPDGRTLIVGGEASNLSIW--DLASPTPRIKAELTSAAPACYALAISPDSK--VCFSCCSDGN 557
            . |.|.:.|..|.:.:.:.:|  :|.:....|:|:    |..| .:..||.|:  :.|. |:|..
Human   539 FNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAK----ANVC-CVKFSPSSRYHLAFG-CADHC 597

  Fly   558 IAVWDLHN---EILVRQFQGH---------TDGASCIDISPDGS-RLWTGGLDNTVRSWDLREGR 609
            :..:||.|   .|:|  |:||         ..|...:..|.|.. :||..|....:||:   :| 
Human   598 VHYYDLRNTKQPIMV--FKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSF---KG- 656

  Fly   610 QLQQHDFSSQIFSLGYCPTGDWLAVGMENS 639
            .:.:.:|      :|....||::|.|.||:
Human   657 HINEKNF------VGLASNGDYIACGSENN 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 56/237 (24%)
WD40 repeat 447..486 CDD:293791 12/59 (20%)
WD40 repeat 494..532 CDD:293791 10/40 (25%)
WD40 repeat 537..573 CDD:293791 12/40 (30%)
WD40 repeat 580..615 CDD:293791 8/35 (23%)
WD40 repeat 620..653 CDD:293791 7/20 (35%)
WD40 repeat 661..695 CDD:293791
WD40 repeat 702..726 CDD:293791
COP1XP_016857548.1 RING-HC_COP1 132..177 CDD:319418
PLN00181 <240..725 CDD:177776 101/485 (21%)
WD40 repeat 491..528 CDD:293791 6/37 (16%)
WD40 repeat 535..571 CDD:293791 8/35 (23%)
WD40 repeat 576..614 CDD:293791 12/41 (29%)
WD40 repeat 620..659 CDD:293791 9/42 (21%)
WD40 repeat 663..685 CDD:293791 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.