DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and dic1

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001342791.1 Gene:dic1 / 5802757 PomBaseID:SPBC646.17c Length:544 Species:Schizosaccharomyces pombe


Alignment Length:313 Identity:61/313 - (19%)
Similarity:102/313 - (32%) Gaps:108/313 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   450 VTISNPTKY---VYTGG--KGCVKVWDISQ------------PGNKNPVSQLDCLQRDNYIRSVK 497
            :|:..|:.:   :..||  .|.|.:||:.|            .|:..||:.:      .||.:  
pombe   246 ITVCKPSPFHPQLIAGGAYNGQVFLWDLRQGQYPVSFTTIISGGHLEPVTDI------TYINN-- 302

  Fly   498 LLPDGRTLIVGGEASNLSIWD-----LASPTPRIKAELTSAAPACYALAIS--PDSKVCFSC-CS 554
              |....::.......:.||:     ..|.|..:.:::.|::....|..:|  |::.:.|.. ..
pombe   303 --PPSNNIVTCSTDGLVHIWEPDMFSRPSETICLSSQVDSSSQCIPATCLSFIPENNMEFLVGAE 365

  Fly   555 DGNI--AVWDLHNEILVRQ-----FQGHTDGASCIDISPDGSR----------LWTGGLDNTVRS 602
            ||.:  .....::|....|     ::||....|.||:....|:          ..|...|.|||.
pombe   366 DGKLQRGYRSDYSETKAVQPSNVSYEGHNVFISGIDVMTSNSQNVFLEKNKDFALTSSFDWTVRL 430

  Fly   603 WDLREGRQLQQH------DFSSQIFSLGYCPTGDWLAVGMENSHVEVLHASKPDKYQLHLHESCV 661
            |.....|  .||      |...|:. :..|.|                          ..|::.|
pombe   431 WQCSPSR--NQHELVPSNDLDEQVI-INSCKT--------------------------FTHKAMV 466

  Fly   662 LSLRFAACGKWFVS-----TGKDNL--LNAWRTPYGASIFQSKETSSVLSCDI 707
            ..:      ||.||     ...|.|  ||.|..        .|:..:.::.||
pombe   467 FDV------KWCVSEPCCFASVDALGNLNLWDL--------QKDVEAPVTSDI 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 61/313 (19%)
WD40 repeat 447..486 CDD:293791 12/52 (23%)
WD40 repeat 494..532 CDD:293791 5/42 (12%)
WD40 repeat 537..573 CDD:293791 8/45 (18%)
WD40 repeat 580..615 CDD:293791 13/50 (26%)
WD40 repeat 620..653 CDD:293791 2/32 (6%)
WD40 repeat 661..695 CDD:293791 10/40 (25%)
WD40 repeat 702..726 CDD:293791 2/6 (33%)
dic1NP_001342791.1 WD40 223..536 CDD:330360 61/313 (19%)
WD40 repeat 247..289 CDD:293791 9/41 (22%)
WD40 repeat 294..339 CDD:293791 8/54 (15%)
WD40 repeat 348..390 CDD:293791 7/41 (17%)
WD40 repeat 397..453 CDD:293791 15/57 (26%)
WD40 repeat 466..504 CDD:293791 11/51 (22%)
WD40 repeat 511..535 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.