| Sequence 1: | NP_996298.1 | Gene: | gro / 43162 | FlyBaseID: | FBgn0001139 | Length: | 730 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001073654.1 | Gene: | traf7 / 563746 | ZFINID: | ZDB-GENE-070112-2212 | Length: | 639 | Species: | Danio rerio |
| Alignment Length: | 205 | Identity: | 54/205 - (26%) |
|---|---|---|---|
| Similarity: | 89/205 - (43%) | Gaps: | 43/205 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 436 RQINTL-SHGEVVCAVTISNPTKYVYTGGKGCVKVWDI---------SQPGNKNPVSQLDCLQRD 490
Fly 491 NY-----------IRSVK----LLPDGRTL---------IVGGEASNL-SIWDLASPTPRIKAEL 530
Fly 531 TSAAPACYALAI--SPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWT 593
Fly 594 GGLDNTVRSW 603 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| gro | NP_996298.1 | TLE_N | 11..124 | CDD:397828 | |
| WD40 | 442..727 | CDD:238121 | 52/198 (26%) | ||
| WD40 repeat | 447..486 | CDD:293791 | 12/47 (26%) | ||
| WD40 repeat | 494..532 | CDD:293791 | 13/51 (25%) | ||
| WD40 repeat | 537..573 | CDD:293791 | 13/37 (35%) | ||
| WD40 repeat | 580..615 | CDD:293791 | 8/24 (33%) | ||
| WD40 repeat | 620..653 | CDD:293791 | |||
| WD40 repeat | 661..695 | CDD:293791 | |||
| WD40 repeat | 702..726 | CDD:293791 | |||
| traf7 | NP_001073654.1 | RING | 100..132 | CDD:214546 | |
| Sina | 141..>249 | CDD:302762 | |||
| Snapin_Pallidin | 260..342 | CDD:291383 | |||
| WD40 | <349..637 | CDD:225201 | 53/203 (26%) | ||
| WD40 | 357..637 | CDD:238121 | 53/203 (26%) | ||
| WD40 repeat | 368..406 | CDD:293791 | |||
| WD40 repeat | 412..446 | CDD:293791 | 2/6 (33%) | ||
| WD40 repeat | 451..486 | CDD:293791 | 9/36 (25%) | ||
| WD40 repeat | 493..525 | CDD:293791 | 6/31 (19%) | ||
| WD40 repeat | 531..565 | CDD:293791 | 8/35 (23%) | ||
| WD40 repeat | 573..608 | CDD:293791 | 12/34 (35%) | ||
| WD40 repeat | 615..637 | CDD:293791 | 7/23 (30%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||