DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and wdr74

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001070031.1 Gene:wdr74 / 558996 ZFINID:ZDB-GENE-060929-1138 Length:375 Species:Danio rerio


Alignment Length:217 Identity:46/217 - (21%)
Similarity:92/217 - (42%) Gaps:13/217 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   444 GEVVCAVTISNPTK-YVYTGGK-GCVKVWDISQPGN-----KNPVSQLDCLQRDNYIRSVKLLPD 501
            |:.:|.:..:...: :|.|||| ..:||||:.:|..     ||.......::...::|.:..:.|
Zfish   125 GKDICKMRQNQSQRHHVATGGKENPLKVWDLEKPDKPIFTAKNVAHDWLEMRVPVWVRDISFIAD 189

  Fly   502 GRTLIVGGEASNLSIWDLASP--TPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLH 564
            ...::.......:.::|.::|  .|.::|:.........:|..|.|:.|..:  :.|.:|:.||.
Zfish   190 SDKIVTCTGHHKVRVYDPSTPQRRPVLEADFGEYPLTALSLPASQDAVVVGN--THGELAILDLR 252

  Fly   565 NEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQHDFSSQIFSLGYCPTG 629
            ..::...|:|.......:...|....:.:.|||..:|...| |.|.||...:.....:.....:.
Zfish   253 KGLVRGCFKGLAGAVRGLQCHPSLPLVASCGLDRFLRVHSL-EDRSLQHKVYLKSRLNCVLLSSR 316

  Fly   630 DWLAVGMENSHVEVLHASKPDK 651
            | |....::..||.:.|.:.|:
Zfish   317 D-LESSSDSGDVEEVKAEEEDE 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 46/217 (21%)
WD40 repeat 447..486 CDD:293791 13/45 (29%)
WD40 repeat 494..532 CDD:293791 6/39 (15%)
WD40 repeat 537..573 CDD:293791 8/35 (23%)
WD40 repeat 580..615 CDD:293791 10/34 (29%)
WD40 repeat 620..653 CDD:293791 6/32 (19%)
WD40 repeat 661..695 CDD:293791
WD40 repeat 702..726 CDD:293791
wdr74NP_001070031.1 WD40 repeat 44..82 CDD:293791
WD40 <52..325 CDD:225201 42/203 (21%)
WD40 repeat 125..166 CDD:293791 12/40 (30%)
WD40 137..>300 CDD:295369 37/165 (22%)
WD40 repeat 182..219 CDD:293791 5/36 (14%)
WD40 repeat 225..261 CDD:293791 8/37 (22%)
WD40 repeat 267..309 CDD:293791 10/42 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.