DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and ATG16L1

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001350671.1 Gene:ATG16L1 / 55054 HGNCID:21498 Length:624 Species:Homo sapiens


Alignment Length:753 Identity:148/753 - (19%)
Similarity:251/753 - (33%) Gaps:274/753 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ERIKEEFNFL--QAQYHSI---KLECEK-----------------LSNEKTEMQRHYVMYYEMSY 71
            |.|..::|.|  ::..||:   ||:.||                 ..|:..||.:..:.:.|.. 
Human    33 EEIILQYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEEL- 96

  Fly    72 GLNVEMHKQT-EIAKRLNTLINQLLPFLQADHQQQV--------LQAVE---------RAKQVTM 118
               .|:||:. |:|:.:..|.||:   .:.|.:.|:        ||.:.         |.|...:
Human    97 ---TELHKKRGELAQLVIDLNNQM---QRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDL 155

  Fly   119 QELNLIIGHQQQHGIQQLLQQIHAQQVPGGPPQPMGALNPFGALGATMGLPHGPQGLLNKPPEHH 183
            :..|           |.|..:..|.|:            .|.||          :|.|.|..|.:
Human   156 ERAN-----------QTLKDEYDALQI------------TFTAL----------EGKLRKTTEEN 187

  Fly   184 RPDIKPTGLEGPAAAEERLRNSVSPADREKYRTRSPLDIEND-SKRRKDEKLQEDEGEKSDQDLV 247
                               :..|:....||.:..:.|:.||: ..||:..:||::..|.:.:.|.
Human   188 -------------------QELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLP 233

  Fly   248 VDVANEMESHSPRPNGEHVSMEVRDRESLNGERLEKPSSSGIKQERPPSRSGSSSSRSTPSLKTK 312
            |:..:::|          |.::               .:|...:|..|.|               
Human   234 VEQDDDIE----------VIVD---------------ETSDHTEETSPVR--------------- 258

  Fly   313 DMEKPGTPGAKARTPTPNAAAPAPGVNPKQMMPQG---PPPAGYPGAPYQRPADPYQRPPSDPAY 374
                     |.:|..|...:.||.|:........|   .|..|:..:             ||.|.
Human   259 ---------AISRAATKRLSQPAGGLLDSITNIFGLSESPLLGHHSS-------------SDAAR 301

  Fly   375 GRPP---PMPYDPHAHVRTNGIPHPSALTGGKPAYSFHMNGEGSLQPVPFPPDALVGVGIPRHAR 436
            .|..   |:|.|       |...||                 ||.:.|..|..||  .....|..
Human   302 RRSVSSFPVPQD-------NVDTHP-----------------GSGKEVRVPATAL--CVFDAHDG 340

  Fly   437 QINTLSHGEVVCAVTISNPTKYVYTGGKG-CVKVWDI---------SQPGNKNPVSQL------- 484
            ::|         ||..|..::.:.|||.. .||:|::         |..|:...::.:       
Human   341 EVN---------AVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGS 396

  Fly   485 -------DCLQR----DNY------------IRSVKLLPDGRTLIVGGEASNLSIWDLASPTPRI 526
                   |...|    |:|            :.|.|.|.|...::.|.....|.:|||.|   ::
Human   397 YLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRS---KV 458

  Fly   527 KAELTSAAPACYALAISPDSKVCFSCC-----SDGNIAVWDLHNEILVRQFQ--GHTDGASCIDI 584
            ..:...|..:|       :..||...|     .|..|..||:.:|.:||:.:  |.   .:.:|:
Human   459 CIKTVFAGSSC-------NDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGK---ITALDL 513

  Fly   585 SPDGSRLWTGGLDNTVRSWDLREGRQLQQHDFSSQIFSLG-------YCPTGDWLAVGMENSHVE 642
            :|:.:.|.:...|:.::..|||.....|  .||:..|..|       :.|.|.::|.|.....:.
Human   514 NPERTELLSCSRDDLLKVIDLRTNAIKQ--TFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLY 576

  Fly   643 V--LHASKPDKYQLHLHESCVLSLRFAACGKWFVSTGK 678
            :  :...|.:|.....|.|.:.::.::..|...||..|
Human   577 IWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDK 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828 29/134 (22%)
WD40 442..727 CDD:238121 62/293 (21%)
WD40 repeat 447..486 CDD:293791 11/62 (18%)
WD40 repeat 494..532 CDD:293791 10/37 (27%)
WD40 repeat 537..573 CDD:293791 11/40 (28%)
WD40 repeat 580..615 CDD:293791 8/34 (24%)
WD40 repeat 620..653 CDD:293791 8/41 (20%)
WD40 repeat 661..695 CDD:293791 4/18 (22%)
WD40 repeat 702..726 CDD:293791
ATG16L1NP_001350671.1 ATG16 31..206 CDD:312208 43/231 (19%)
WD40 <272..390 CDD:225201 34/165 (21%)
WD40 332..622 CDD:238121 65/309 (21%)
WD40 repeat 344..381 CDD:293791 10/36 (28%)
WD40 repeat 387..423 CDD:293791 4/35 (11%)
WD40 repeat 428..465 CDD:293791 10/39 (26%)
WD40 repeat 473..503 CDD:293791 10/29 (34%)
WD40 repeat 508..544 CDD:293791 8/37 (22%)
WD40 repeat 554..590 CDD:293791 6/35 (17%)
WD40 repeat 597..621 CDD:293791 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.