Sequence 1: | NP_996298.1 | Gene: | gro / 43162 | FlyBaseID: | FBgn0001139 | Length: | 730 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001016608.1 | Gene: | poc1a / 549362 | XenbaseID: | XB-GENE-5767105 | Length: | 441 | Species: | Xenopus tropicalis |
Alignment Length: | 304 | Identity: | 67/304 - (22%) |
---|---|---|---|
Similarity: | 125/304 - (41%) | Gaps: | 47/304 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 431 IPRHARQINTLSHGEVVCAVTISNPTKYVYTGG-KGCVKVWDISQP-------GNKNPVSQLD-- 485
Fly 486 -------CLQRD---------------------NYIRSVKLLPDGRTLIVGGEASNLSIWDLASP 522
Fly 523 TPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPD 587
Fly 588 GSRLWTGGLDNTVRSWDLREGRQLQQHDFSSQIF-SLGYCPTGDWLAVGMENSHVEVLHASKPD- 650
Fly 651 KYQLHLHESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIF 694 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
gro | NP_996298.1 | TLE_N | 11..124 | CDD:397828 | |
WD40 | 442..727 | CDD:238121 | 65/293 (22%) | ||
WD40 repeat | 447..486 | CDD:293791 | 10/55 (18%) | ||
WD40 repeat | 494..532 | CDD:293791 | 8/37 (22%) | ||
WD40 repeat | 537..573 | CDD:293791 | 8/35 (23%) | ||
WD40 repeat | 580..615 | CDD:293791 | 11/34 (32%) | ||
WD40 repeat | 620..653 | CDD:293791 | 8/34 (24%) | ||
WD40 repeat | 661..695 | CDD:293791 | 10/34 (29%) | ||
WD40 repeat | 702..726 | CDD:293791 | |||
poc1a | NP_001016608.1 | WD40 | 10..298 | CDD:238121 | 65/294 (22%) |
WD 1 | 16..55 | 8/38 (21%) | |||
WD40 repeat | 21..58 | CDD:293791 | 7/36 (19%) | ||
WD 2 | 58..97 | 5/38 (13%) | |||
WD40 repeat | 64..100 | CDD:293791 | 3/35 (9%) | ||
WD 3 | 100..139 | 7/40 (18%) | |||
WD40 repeat | 105..141 | CDD:293791 | 7/37 (19%) | ||
WD 4 | 142..181 | 8/38 (21%) | |||
WD40 repeat | 148..182 | CDD:293791 | 8/33 (24%) | ||
WD 5 | 184..223 | 11/38 (29%) | |||
WD40 repeat | 189..225 | CDD:293791 | 11/35 (31%) | ||
WD 6 | 226..265 | 9/38 (24%) | |||
WD40 repeat | 231..267 | CDD:293791 | 9/35 (26%) | ||
WD 7 | 268..307 | 11/39 (28%) | |||
WD40 repeat | 273..297 | CDD:293791 | 8/23 (35%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 323..380 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |