Sequence 1: | NP_996298.1 | Gene: | gro / 43162 | FlyBaseID: | FBgn0001139 | Length: | 730 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001015781.1 | Gene: | eif3i / 548498 | XenbaseID: | XB-GENE-974377 | Length: | 325 | Species: | Xenopus tropicalis |
Alignment Length: | 197 | Identity: | 44/197 - (22%) |
---|---|---|---|
Similarity: | 82/197 - (41%) | Gaps: | 15/197 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 545 DSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGR 609
Fly 610 QLQQHDFSSQIFSLGYCPTGDWLAVGMENS-----HVEVLHASKPDKYQ-------LHLHESCVL 662
Fly 663 SLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKETSSVLSCDIST--DDKYIVTGSGDKKATV 725
Fly 726 YE 727 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
gro | NP_996298.1 | TLE_N | 11..124 | CDD:397828 | |
WD40 | 442..727 | CDD:238121 | 44/195 (23%) | ||
WD40 repeat | 447..486 | CDD:293791 | |||
WD40 repeat | 494..532 | CDD:293791 | |||
WD40 repeat | 537..573 | CDD:293791 | 6/27 (22%) | ||
WD40 repeat | 580..615 | CDD:293791 | 12/34 (35%) | ||
WD40 repeat | 620..653 | CDD:293791 | 4/37 (11%) | ||
WD40 repeat | 661..695 | CDD:293791 | 5/33 (15%) | ||
WD40 repeat | 702..726 | CDD:293791 | 8/25 (32%) | ||
eif3i | NP_001015781.1 | WD40 | 6..311 | CDD:392136 | 44/197 (22%) |
WD 1 | 8..47 | 6/25 (24%) | |||
WD40 repeat | 14..50 | CDD:293791 | 6/28 (21%) | ||
WD 2 | 50..89 | 15/38 (39%) | |||
WD40 repeat | 55..91 | CDD:293791 | 12/35 (34%) | ||
WD 3 | 144..183 | 7/38 (18%) | |||
WD40 repeat | 150..185 | CDD:293791 | 5/34 (15%) | ||
WD 4 | 186..225 | 10/32 (31%) | |||
WD40 repeat | 191..226 | CDD:293791 | 8/27 (30%) | ||
WD40 repeat | 232..272 | CDD:293791 | |||
WD 5 | 283..324 | ||||
WD40 repeat | 288..311 | CDD:293791 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |