DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and WDR74

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001356376.1 Gene:WDR74 / 54663 HGNCID:25529 Length:399 Species:Homo sapiens


Alignment Length:299 Identity:71/299 - (23%)
Similarity:110/299 - (36%) Gaps:57/299 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 SLQPVPFP-PDA----------LVGVGIPRHARQINTLSHGEVVCAVTISNPTKYVYTGGK-GCV 467
            |..||..| ||.          .||.|:   .|.....:|..||.            |||| ..:
Human   120 SSDPVRLPCPDGWGRWAGLLELRVGPGV---CRMRQDPAHPHVVA------------TGGKENAL 169

  Fly   468 KVWDISQPGNKNPVSQLDCLQRD-------NYIRSVKLLPDGRTLIVGGEASNLSIWDLASPTPR 525
            |:||:.  |::.||.:...::.|       .:.:.::.||..:.|:.......:.::|.|||..|
Human   170 KIWDLQ--GSEEPVFRAKNVRNDWLDLRVPIWDQDIQFLPGSQKLVTCTGYHQVRVYDPASPQRR 232

  Fly   526 IKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSR 590
            ...|.|.......|:.::|.........:.|.:|..||....|:...:|.......:...|....
Human   233 PVLETTYGEYPLTAMTLTPGGNSVIVGNTHGQLAEIDLRQGRLLGCLKGLAGSVRGLQCHPSKPL 297

  Fly   591 LWTGGLDNTVRSWDLREGRQLQQHDF-SSQIFSLGYCPTGDWLAVGMENSHVEVLHASKPDKYQL 654
            |.:.|||..:|...::..|.|:...: .||:..|        |..|.:|...|.....:|:|..|
Human   298 LASCGLDRVLRIHRIQNPRGLEHKVYLKSQLNCL--------LLSGRDNWEDEPQEPQEPNKVPL 354

  Fly   655 HLHESCVL--SLRFAACGKWFVSTGKDNLLNAWRTPYGA 691
            ...|:..|  ||..||..|          |:....|.||
Human   355 EDTETDELWASLEAAAKRK----------LSGLEQPQGA 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 61/261 (23%)
WD40 repeat 447..486 CDD:293791 11/39 (28%)
WD40 repeat 494..532 CDD:293791 9/37 (24%)
WD40 repeat 537..573 CDD:293791 7/35 (20%)
WD40 repeat 580..615 CDD:293791 8/34 (24%)
WD40 repeat 620..653 CDD:293791 7/32 (22%)
WD40 repeat 661..695 CDD:293791 10/33 (30%)
WD40 repeat 702..726 CDD:293791
WDR74NP_001356376.1 WD40 45..316 CDD:356469 48/212 (23%)
WD40 repeat 45..85 CDD:293791
WD40 repeat 91..137 CDD:293791 6/16 (38%)
WD40 repeat 147..185 CDD:293791 14/54 (26%)
WD40 repeat 199..238 CDD:293791 9/38 (24%)
WD40 repeat 244..280 CDD:293791 7/35 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.