DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and WDR44

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_061918.3 Gene:WDR44 / 54521 HGNCID:30512 Length:913 Species:Homo sapiens


Alignment Length:783 Identity:142/783 - (18%)
Similarity:236/783 - (30%) Gaps:309/783 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 PAAAEERLRN--------SVSPADREKYRTRSPLDIENDSKRRK----DEKLQE--DEGEKSDQD 245
            |..|...|.|        .|.|.:.:|..:::..: |.:.:.:|    ||..::  ||..|..|.
Human    97 PIVARTDLSNIPGLLAIDQVLPEESQKAESQNTFE-ETELELKKCFPSDETCEKPVDETTKLTQT 160

  Fly   246 LVVDVANEMESHSPRPNGEHVSMEVRDRESLNGERLEKPSSSGIKQERPPSRSGSSSSRSTPSLK 310
            ...:..|.:|:.:...|.|  ::||:.    .|:.||..||.                    ||.
Human   161 SSTEQLNVLETETEVLNKE--AVEVKG----GGDVLEPVSSD--------------------SLS 199

  Fly   311 TKDME-----KPGTPGAKARTPTPNAAAPAPGVNPKQMMP-QGPPPAGYPGAPYQRPADPYQRPP 369
            |||..     .|..| .:..||.|:..|     :.|:.:| :.|||..:|        .|...||
Human   200 TKDFAAVEEVAPAKP-PRHLTPEPDIVA-----STKKPVPARPPPPTNFP--------PPRPPPP 250

  Fly   370 SDPAYGRPPP------MPYD----PHAHVRTNGIPHPSALTGGKPAYSFHMNGEGSL-------- 416
            |.||   |||      :.::    |...|....|...|.||....:.|...:.:.||        
Human   251 SRPA---PPPRKRKSELEFETLKTPDIDVPKENITSDSLLTASMASESTVKDSQPSLDLASATSG 312

  Fly   417 ------QPVPFPPDA------LVGVGIPRHARQINTLSHGEVVCAVTISNPTKYVYTGGKGCVKV 469
                  |.....||.      ::|...|| :.....|:..|::.:|.|.|    :.||.:..:.:
Human   313 DKIVTAQENGKAPDGQTVAGEVMGPQRPR-SNSGRELTDEEILASVMIKN----LDTGEEIPLSL 372

  Fly   470 WDISQPGNKNPVS-----------QLDCLQRD--------------------------------- 490
            .:...|...||::           ..|..|.|                                 
Human   373 AEEKLPTGINPLTLHIMRRTKEYVSNDAAQSDDEEKLQSQPTDTDGGRLKQKTTQLKKFLGKSVK 437

  Fly   491 --------------NYIRSV-------------------------------------------KL 498
                          |.::||                                           |:
Human   438 RAKHLAEEYGERAINKVKSVRDEVFHTDQDDPSSSDDEGMPYTRPVKFKAAHGFKGPYDFDQIKV 502

  Fly   499 LPD-----------------GRTLIVGGEASNLSIWDL-------------------ASPTPRIK 527
            :.|                 ||.|...|:.:.:.||.|                   .||:|..:
Human   503 VQDLSGEHMGAVWTMKFSHCGRLLASAGQDNVVRIWALKNAFDYFNNMRMKYNTEGRVSPSPSQE 567

  Fly   528 AELTSAAP----ACYALAISPDSK--------VC--------------------FSCCSDGNIAV 560
            :..:|.:.    .|......||.|        .|                    .|...|..:.:
Human   568 SLSSSKSDTDTGVCSGTDEDPDDKNAPFRQRPFCKYKGHTADLLDLSWSKNYFLLSSSMDKTVRL 632

  Fly   561 WDLHNEILVRQFQGHTDGASCIDISPDGSRLW-TGGLDNTVRSWDLREGRQLQQHDFSSQ---IF 621
            |.:.....:..|| |.|..:.|...|...|.: :|.||..:|.|::.:.:....::...|   |.
Human   633 WHISRRECLCCFQ-HIDFVTAIAFHPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLIT 696

  Fly   622 SLGYCPTGDWLAVGMENSHVEVLHASKPDKYQLHLHESCVLSLRFAACGKWFVS----------- 675
            :..:|..|.:..:|..:... :.:.::..||...:|   |.|.|    |:..|.           
Human   697 AANFCQNGKYAVIGTYDGRC-IFYDTEHLKYHTQIH---VRSTR----GRNKVGRKITGIEPLPG 753

  Fly   676 ------TGKDNLLNAW-------RTPYGASIFQSKETSSVLSCDISTDDKYIVTGSGDKKATVYE 727
                  |..|:.:..:       ...|...:    .:||.:....|.|..|:|:||.||...::.
Human   754 ENKILVTSNDSRIRLYDLRDLSLSMKYKGYV----NSSSQIKASFSHDFTYLVSGSEDKYVYIWS 814

  Fly   728 VIY 730
            ..:
Human   815 TYH 817

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 74/481 (15%)
WD40 repeat 447..486 CDD:293791 8/49 (16%)
WD40 repeat 494..532 CDD:293791 14/116 (12%)
WD40 repeat 537..573 CDD:293791 8/63 (13%)
WD40 repeat 580..615 CDD:293791 8/35 (23%)
WD40 repeat 620..653 CDD:293791 5/32 (16%)
WD40 repeat 661..695 CDD:293791 8/57 (14%)
WD40 repeat 702..726 CDD:293791 8/23 (35%)
WDR44NP_061918.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Binding activity 2..170 16/73 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..348 36/160 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..424 3/26 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 459..480 0/20 (0%)
WD 1 509..548 7/38 (18%)
WD40 510..857 CDD:238121 57/321 (18%)
WD40 repeat 514..562 CDD:293791 7/47 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 557..593 8/35 (23%)
WD 2 605..643 3/37 (8%)
WD40 repeat 610..644 CDD:293791 3/33 (9%)
WD 3 645..685 11/40 (28%)
WD40 repeat 651..688 CDD:293791 8/36 (22%)
WD 4 690..729 7/39 (18%)
WD40 repeat 695..730 CDD:293791 6/35 (17%)
WD 5 740..779 3/38 (8%)
WD40 repeat 745..785 CDD:293791 3/43 (7%)
WD 6 784..823 10/38 (26%)
WD40 repeat 789..813 CDD:293791 8/23 (35%)
WD 7 876..913
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.