DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and wds

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster


Alignment Length:405 Identity:85/405 - (20%)
Similarity:151/405 - (37%) Gaps:73/405 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 MMPQGPPPAGYPGAPYQRPADPYQRPPSDPAYGRPPPMPYDPHAHVRTNGIPHPSALTGGKPAYS 407
            |:|.|....|:||..:         ||..|.    |..|..|:: ::.|.:..|.|.|....:.|
  Fly     1 MVPIGAVHGGHPGVVH---------PPQQPL----PTAPSGPNS-LQPNSVGQPGATTSSNSSAS 51

  Fly   408 FHMNGEGSLQPVPFPPDALVGVGIPRHARQINTLSHGEVVCAVTIS-NPTKYVYTGGKGCVKVW- 470
                .:.||...            |.:..:.....|.:.|.||..| |......:.....:|:| 
  Fly    52 ----NKSSLSVK------------PNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWG 100

  Fly   471 ------DISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLASPTPRIKAE 529
                  :.:..|:|..:|            .|....|.|.|:.|.:...|.:|:|:  |.:....
  Fly   101 AYDGKFEKTISGHKLGIS------------DVAWSSDSRLLVSGSDDKTLKVWELS--TGKSLKT 151

  Fly   530 LTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTG 594
            |...:...:....:|.|.:..|...|.::.:||:.....::....|:|..|.:..:.|||.:.:.
  Fly   152 LKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSS 216

  Fly   595 GLDNTVRSWDLREGRQLQQ--HDFSSQIFSLGYCPTGDWLAVGMENSHVEVLHASKP---DKYQL 654
            ..|...|.||...|:.|:.  .|.:..:..:.:.|.|.::.....::.:::...||.   ..|..
  Fly   217 SYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTG 281

  Fly   655 HLHES-CVLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKE--------TSSVLSCDISTD 710
            |.:|. |:.:......|||.||..:||::..|.       .||||        |.:||.......
  Fly   282 HKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWN-------LQSKEVVQKLQGHTDTVLCTACHPT 339

  Fly   711 DKYIVTGSGDKKATV 725
            :..|.:.:.:...|:
  Fly   340 ENIIASAALENDKTI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 65/306 (21%)
WD40 repeat 447..486 CDD:293791 10/46 (22%)
WD40 repeat 494..532 CDD:293791 10/37 (27%)
WD40 repeat 537..573 CDD:293791 6/35 (17%)
WD40 repeat 580..615 CDD:293791 10/36 (28%)
WD40 repeat 620..653 CDD:293791 4/35 (11%)
WD40 repeat 661..695 CDD:293791 8/33 (24%)
WD40 repeat 702..726 CDD:293791 4/24 (17%)
wdsNP_001245503.1 WD40 64..358 CDD:238121 65/312 (21%)
WD40 repeat 75..112 CDD:293791 7/36 (19%)
WD40 repeat 118..154 CDD:293791 11/49 (22%)
WD40 repeat 159..195 CDD:293791 6/35 (17%)
WD40 repeat 202..237 CDD:293791 10/34 (29%)
WD40 repeat 244..280 CDD:293791 4/35 (11%)
WD40 repeat 288..325 CDD:293791 13/43 (30%)
WD40 repeat 331..357 CDD:293791 4/24 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.