| Sequence 1: | NP_996298.1 | Gene: | gro / 43162 | FlyBaseID: | FBgn0001139 | Length: | 730 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001011103.1 | Gene: | utp15 / 496516 | XenbaseID: | XB-GENE-491403 | Length: | 515 | Species: | Xenopus tropicalis |
| Alignment Length: | 223 | Identity: | 55/223 - (24%) |
|---|---|---|---|
| Similarity: | 98/223 - (43%) | Gaps: | 12/223 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 501 DGRTLIVGGEASNLSIWDLASPTPRIKAEL---TSAAPACYALAISPDSKVCFSCCSDGNIAVWD 562
Fly 563 LHNEILVRQFQGHTDGASCIDISPDGSRLW-TGGLDNTVRSWDLREGRQLQQHDFSSQIFSLGYC 626
Fly 627 PTGDWLAVGMENSHVEVLHASKPDKYQLHL--HESCVLSLRFAACGKWFVSTGKDNLLNAWRTPY 689
Fly 690 GASIFQSKETSSVLSCDISTDDKYIVTG 717 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| gro | NP_996298.1 | TLE_N | 11..124 | CDD:397828 | |
| WD40 | 442..727 | CDD:238121 | 55/223 (25%) | ||
| WD40 repeat | 447..486 | CDD:293791 | |||
| WD40 repeat | 494..532 | CDD:293791 | 10/33 (30%) | ||
| WD40 repeat | 537..573 | CDD:293791 | 6/35 (17%) | ||
| WD40 repeat | 580..615 | CDD:293791 | 9/35 (26%) | ||
| WD40 repeat | 620..653 | CDD:293791 | 8/32 (25%) | ||
| WD40 repeat | 661..695 | CDD:293791 | 7/33 (21%) | ||
| WD40 repeat | 702..726 | CDD:293791 | 7/16 (44%) | ||
| utp15 | NP_001011103.1 | WD 1 | 36..75 | ||
| WD40 repeat | 41..79 | CDD:293791 | |||
| WD40 | 72..332 | CDD:238121 | 55/223 (25%) | ||
| WD 2 | 78..117 | 10/30 (33%) | |||
| WD40 repeat | 84..120 | CDD:293791 | 10/33 (30%) | ||
| WD 3 | 120..159 | 7/38 (18%) | |||
| WD40 repeat | 125..161 | CDD:293791 | 6/35 (17%) | ||
| WD 4 | 162..202 | 12/39 (31%) | |||
| WD40 repeat | 172..204 | CDD:293791 | 8/31 (26%) | ||
| WD 5 | 204..242 | 9/38 (24%) | |||
| WD40 repeat | 209..245 | CDD:293791 | 8/36 (22%) | ||
| WD 6 | 246..285 | 8/38 (21%) | |||
| WD40 repeat | 251..282 | CDD:293791 | 7/30 (23%) | ||
| WD 7 | 287..326 | 8/21 (38%) | |||
| WD40 repeat | 292..315 | CDD:293791 | 7/16 (44%) | ||
| UTP15_C | 344..491 | CDD:312775 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||