| Sequence 1: | NP_996298.1 | Gene: | gro / 43162 | FlyBaseID: | FBgn0001139 | Length: | 730 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_021335278.1 | Gene: | gnb4b / 492811 | ZFINID: | ZDB-GENE-041114-167 | Length: | 340 | Species: | Danio rerio |
| Alignment Length: | 282 | Identity: | 61/282 - (21%) |
|---|---|---|---|
| Similarity: | 108/282 - (38%) | Gaps: | 51/282 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 465 GCVKVWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLASPTPRIKAE 529
Fly 530 LTSAAPACYALAISPDSKVCFSCC------------SDGNIAVWDLHNEILVRQFQGHTDGASCI 582
Fly 583 DISPDGSRLWTGGLDNTVRSWDLREGRQLQQHDFS---SQIFSLGYCPTGDWLAVGMENSHVEVL 644
Fly 645 HASKPDKYQLHLHES--C-VLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKETSSVL--- 703
Fly 704 ----SC-DISTDDKYIVTGSGD 720 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| gro | NP_996298.1 | TLE_N | 11..124 | CDD:397828 | |
| WD40 | 442..727 | CDD:238121 | 61/282 (22%) | ||
| WD40 repeat | 447..486 | CDD:293791 | 6/20 (30%) | ||
| WD40 repeat | 494..532 | CDD:293791 | 6/37 (16%) | ||
| WD40 repeat | 537..573 | CDD:293791 | 8/47 (17%) | ||
| WD40 repeat | 580..615 | CDD:293791 | 9/34 (26%) | ||
| WD40 repeat | 620..653 | CDD:293791 | 4/32 (13%) | ||
| WD40 repeat | 661..695 | CDD:293791 | 8/33 (24%) | ||
| WD40 repeat | 702..726 | CDD:293791 | 9/27 (33%) | ||
| gnb4b | XP_021335278.1 | WD40 | 48..340 | CDD:238121 | 61/282 (22%) |
| WD40 repeat | 58..95 | CDD:293791 | 5/18 (28%) | ||
| WD40 repeat | 101..141 | CDD:293791 | 6/39 (15%) | ||
| WD40 repeat | 146..181 | CDD:293791 | 7/34 (21%) | ||
| WD40 repeat | 188..223 | CDD:293791 | 9/36 (25%) | ||
| WD40 repeat | 229..265 | CDD:293791 | 4/35 (11%) | ||
| WD40 repeat | 273..309 | CDD:293791 | 10/42 (24%) | ||
| WD40 repeat | 315..339 | CDD:293791 | 7/19 (37%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||