| Sequence 1: | NP_996298.1 | Gene: | gro / 43162 | FlyBaseID: | FBgn0001139 | Length: | 730 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001003402.2 | Gene: | Eml5 / 444982 | RGDID: | 1303275 | Length: | 1977 | Species: | Rattus norvegicus |
| Alignment Length: | 653 | Identity: | 122/653 - (18%) |
|---|---|---|---|
| Similarity: | 206/653 - (31%) | Gaps: | 218/653 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 242 SDQDLVVDVANEMESHSPRPNGEHVSMEVRDRESLNGERLEKPSSSGIKQERPPS---RSGSSSS 303
Fly 304 RSTPSLKTKDMEKPGTPGAKARTPTPNAAAPAPGVNPKQMMPQG--PPPAGYPGAPYQRPAD--- 363
Fly 364 PYQRPPSD----PAYG-RPPPMPYDPH---------AHVRTNGIPHPSALTGGKPAYSFHMNGEG 414
Fly 415 SLQPVPFPPDALVGVGIPRHARQINTLSHGEV--------------------------------- 446
Fly 447 -VCAVTISNPTKYVYTGG---KGCVKVW------DISQPGNKNPVSQLDCLQRDNYIRSVKLLPD 501
Fly 502 GRTLIVGGEASNLSIWDLASPTPRIKAELTSA-----APACYALAISPDSKVCFSCCSDGNIAVW 561
Fly 562 DLH-------------------------------------------------------------- 564
Fly 565 ----------NEILVRQ------------------FQGHTDGASC-IDISPDGSRLWTGGLDNTV 600
Fly 601 RSWDLREGRQLQQHDFSSQIFSLGYCPTGDWLAVGMENSHVEVLHASKPDKYQLHLHESCVL-SL 664
Fly 665 RFAACGKWFVSTGKDNLLNAWRTPYGAS---IFQSKETSS-VLSCDISTDDKYIVTGSGDKKATV 725
Fly 726 YEV 728 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| gro | NP_996298.1 | TLE_N | 11..124 | CDD:397828 | |
| WD40 | 442..727 | CDD:238121 | 74/428 (17%) | ||
| WD40 repeat | 447..486 | CDD:293791 | 11/47 (23%) | ||
| WD40 repeat | 494..532 | CDD:293791 | 9/37 (24%) | ||
| WD40 repeat | 537..573 | CDD:293791 | 10/125 (8%) | ||
| WD40 repeat | 580..615 | CDD:293791 | 8/35 (23%) | ||
| WD40 repeat | 620..653 | CDD:293791 | 10/32 (31%) | ||
| WD40 repeat | 661..695 | CDD:293791 | 5/37 (14%) | ||
| WD40 repeat | 702..726 | CDD:293791 | 7/23 (30%) | ||
| Eml5 | NP_001003402.2 | HELP | <5..47 | CDD:281450 | |
| WD40 | 48..474 | CDD:225201 | |||
| WD40 | 57..353 | CDD:295369 | |||
| WD 1 | 59..100 | ||||
| WD40 repeat | 64..104 | CDD:293791 | |||
| WD 2 | 104..145 | ||||
| WD40 repeat | 110..148 | CDD:293791 | |||
| WD 3 | 148..187 | ||||
| WD40 repeat | 153..201 | CDD:293791 | |||
| WD 4 | 195..233 | ||||
| WD40 repeat | 203..233 | CDD:293791 | |||
| WD 5 | 235..273 | ||||
| WD40 repeat | 240..273 | CDD:293791 | |||
| WD 6 | 280..321 | ||||
| WD40 repeat | 286..321 | CDD:293791 | |||
| WD40 | 321..592 | CDD:295369 | |||
| WD 7 | 323..362 | ||||
| WD40 repeat | 328..352 | CDD:293791 | |||
| WD 8 | 364..403 | ||||
| WD40 repeat | 369..401 | CDD:293791 | |||
| WD 9 | 406..445 | ||||
| WD40 | 408..845 | CDD:225201 | |||
| WD40 repeat | 411..451 | CDD:293791 | |||
| WD 10 | 449..488 | ||||
| WD40 repeat | 522..560 | CDD:293791 | |||
| WD 11 | 561..601 | ||||
| HELP | <671..714 | CDD:281450 | |||
| WD40 | 720..1140 | CDD:225201 | |||
| WD40 | 725..1063 | CDD:295369 | |||
| WD 12 | 725..766 | ||||
| WD40 repeat | 730..769 | CDD:293791 | |||
| WD 13 | 770..811 | ||||
| WD40 repeat | 775..852 | CDD:293791 | |||
| WD 14 | 814..853 | ||||
| WD40 repeat | 857..900 | CDD:293791 | |||
| WD 15 | 861..900 | ||||
| WD40 | 895..1140 | CDD:295369 | |||
| WD 16 | 901..940 | ||||
| WD40 repeat | 907..994 | CDD:293791 | |||
| WD40 repeat | 941..992 | CDD:293791 | |||
| WD 17 | 996..1035 | ||||
| WD40 repeat | 1001..1035 | CDD:293791 | |||
| WD 18 | 1038..1077 | ||||
| WD40 repeat | 1043..1069 | CDD:293791 | |||
| WD 19 | 1080..1120 | ||||
| WD40 repeat | 1085..1110 | CDD:293791 | |||
| WD40 repeat | 1128..1166 | CDD:293791 | |||
| WD40 repeat | 1178..1236 | CDD:293791 | |||
| WD 20 | 1236..1276 | 6/17 (35%) | |||
| WD40 repeat | 1241..1266 | CDD:293791 | 3/7 (43%) | ||
| HELP | <1365..1409 | CDD:281450 | 11/44 (25%) | ||
| WD 21 | 1420..1471 | 7/63 (11%) | |||
| WD40 | 1422..1814 | CDD:225201 | 66/403 (16%) | ||
| WD40 repeat | 1426..1475 | CDD:293791 | 5/48 (10%) | ||
| WD40 | 1475..1778 | CDD:295369 | 56/314 (18%) | ||
| WD 22 | 1475..1516 | 9/40 (23%) | |||
| WD40 repeat | 1480..1518 | CDD:293791 | 9/37 (24%) | ||
| WD 23 | 1519..1558 | 11/49 (22%) | |||
| WD40 repeat | 1525..1566 | CDD:293791 | 10/40 (25%) | ||
| WD 24 | 1568..1606 | 7/38 (18%) | |||
| WD40 repeat | 1573..1605 | CDD:293791 | 7/32 (22%) | ||
| WD 25 | 1608..1654 | 0/45 (0%) | |||
| WD40 repeat | 1613..1676 | CDD:293791 | 1/62 (2%) | ||
| WD40 | 1697..1970 | CDD:295369 | 41/163 (25%) | ||
| WD 26 | 1699..1739 | 12/39 (31%) | |||
| WD40 repeat | 1705..1743 | CDD:293791 | 8/37 (22%) | ||
| WD 27 | 1741..1782 | 10/40 (25%) | |||
| WD 28 | 1783..1822 | 5/38 (13%) | |||
| WD40 | 1788..>1971 | CDD:225201 | 18/72 (25%) | ||
| WD40 repeat | 1788..1821 | CDD:293791 | 4/32 (13%) | ||
| WD40 repeat | 1834..1892 | CDD:293791 | 10/26 (38%) | ||
| WD 29 | 1895..1934 | ||||
| WD40 repeat | 1900..1939 | CDD:293791 | |||
| WD 30 | 1940..1977 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||