| Sequence 1: | NP_996298.1 | Gene: | gro / 43162 | FlyBaseID: | FBgn0001139 | Length: | 730 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001245829.1 | Gene: | Plap / 43978 | FlyBaseID: | FBgn0024314 | Length: | 787 | Species: | Drosophila melanogaster |
| Alignment Length: | 334 | Identity: | 70/334 - (20%) |
|---|---|---|---|
| Similarity: | 112/334 - (33%) | Gaps: | 93/334 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 443 HGEVVCAVTIS-NPTKYVYTGGKGCVKVWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLI 506
Fly 507 VGGEASNLSIWDLASPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQ 571
Fly 572 FQGHTD---------------GASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQ---HDFSS 618
Fly 619 QIFSLGYCPTGDWLAVGMEN------SHVEVLHASK-----------PDKYQLH----------- 655
Fly 656 ----------LHESCVLSLRFA----ACGKWFVSTGKDNLL-------NAWRTPYGASIFQSKET 699
Fly 700 SSVLSCDIS 708 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| gro | NP_996298.1 | TLE_N | 11..124 | CDD:397828 | |
| WD40 | 442..727 | CDD:238121 | 70/334 (21%) | ||
| WD40 repeat | 447..486 | CDD:293791 | 11/39 (28%) | ||
| WD40 repeat | 494..532 | CDD:293791 | 9/37 (24%) | ||
| WD40 repeat | 537..573 | CDD:293791 | 9/35 (26%) | ||
| WD40 repeat | 580..615 | CDD:293791 | 9/37 (24%) | ||
| WD40 repeat | 620..653 | CDD:293791 | 10/49 (20%) | ||
| WD40 repeat | 661..695 | CDD:293791 | 8/44 (18%) | ||
| WD40 repeat | 702..726 | CDD:293791 | 5/7 (71%) | ||
| Plap | NP_001245829.1 | WD40 | <4..266 | CDD:225201 | 39/179 (22%) |
| WD40 | 10..305 | CDD:238121 | 47/220 (21%) | ||
| WD40 repeat | 23..64 | CDD:293791 | |||
| WD40 repeat | 70..106 | CDD:293791 | |||
| WD40 repeat | 111..149 | CDD:293791 | 11/40 (28%) | ||
| WD40 repeat | 156..190 | CDD:293791 | 9/37 (24%) | ||
| WD40 repeat | 196..230 | CDD:293791 | 8/34 (24%) | ||
| WD40 repeat | 236..277 | CDD:293791 | 9/53 (17%) | ||
| WD40 repeat | 284..304 | CDD:293791 | 3/20 (15%) | ||
| PFU | 353..462 | CDD:286196 | 16/65 (25%) | ||
| PUL | 531..781 | CDD:285517 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||