DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and CstF50

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_651883.1 Gene:CstF50 / 43734 FlyBaseID:FBgn0039867 Length:424 Species:Drosophila melanogaster


Alignment Length:278 Identity:58/278 - (20%)
Similarity:117/278 - (42%) Gaps:37/278 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   481 VSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLASPTPRI--KAELTSAAPACYALAIS 543
            ::.:..|...:...|..:|| |..|....|||.|      :|.|..  .|.:||...||.|.|.|
  Fly    58 IAGMQTLSDKDKTNSDDVLP-GIDLEFEPEASAL------APEPHSYETAYVTSHKQACRAGAFS 115

  Fly   544 PDSKVCFSCCSDGNIAVWDLHNEI------------------LVRQFQGHTDGASCIDISPDGSR 590
            .|..:..:...|.:|.:.|:...:                  ::|....|||..|.::..|....
  Fly   116 CDGSLVATGSVDASIKILDVERMLAKSAPEDIEPGREQQGHPVIRTLYDHTDEVSYLEFHPKEHI 180

  Fly   591 LWTGGLDNTVRSWDLREGRQLQQHDFSSQ---IFSLGYCPTGDWLAVGMENSHVEVLHASKPDKY 652
            |.:...|.||:.:|:.:....:.|...:.   :..|.:.||||::|:|.|::.:.|...:....:
  Fly   181 LASASRDGTVKLFDIAKPSVKKAHKVFTDCEPVLCLSFHPTGDYVAIGTEHNVLRVYDVATTQCF 245

  Fly   653 QLHL----HESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYGA---SIFQSKETSSVLSCDISTD 710
            ...:    |::.|..::::..||.:.:...|..:..|....|.   :|.::...:::.|.:.:.:
  Fly   246 VSAIPSQQHKAGVTCVKYSPTGKLYATGSYDGDIKIWDGISGRCINTIAEAHGGAAICSLEFTRN 310

  Fly   711 DKYIVTGSGDKKATVYEV 728
            .||:::...|....::|:
  Fly   311 GKYLLSSGMDSLVYLWEL 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 57/275 (21%)
WD40 repeat 447..486 CDD:293791 0/4 (0%)
WD40 repeat 494..532 CDD:293791 12/39 (31%)
WD40 repeat 537..573 CDD:293791 9/53 (17%)
WD40 repeat 580..615 CDD:293791 7/34 (21%)
WD40 repeat 620..653 CDD:293791 9/32 (28%)
WD40 repeat 661..695 CDD:293791 7/36 (19%)
WD40 repeat 702..726 CDD:293791 4/23 (17%)
CstF50NP_651883.1 CSTF1_dimer 10..63 CDD:406978 0/4 (0%)
WD40 98..417 CDD:238121 46/231 (20%)
WD40 repeat 113..164 CDD:293791 7/50 (14%)
WD40 repeat 170..208 CDD:293791 8/37 (22%)
WD40 repeat 213..251 CDD:293791 9/37 (24%)
WD40 repeat 259..295 CDD:293791 6/35 (17%)
WD40 repeat 302..338 CDD:293791 5/27 (19%)
WD40 repeat 392..417 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.