DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and CG6420

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001287545.1 Gene:CG6420 / 43218 FlyBaseID:FBgn0039451 Length:909 Species:Drosophila melanogaster


Alignment Length:428 Identity:90/428 - (21%)
Similarity:132/428 - (30%) Gaps:177/428 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 PSRSGSSSSRSTPSLKTKDMEKP-------------GTP----GAKARTPTPNAAAPAPGVNPKQ 342
            |:|.|.||::|:|.::...:..|             |||    .|.|.|.|.|.::|        
  Fly    35 PNRVGYSSNQSSPQVRVSMVTLPSPAQGKLGSDVGVGTPVGGGTAGANTTTTNGSSP-------- 91

  Fly   343 MMPQGPPPAGYPGAPYQRPADPYQRPPSDPAYGRPPPMPYDPHAHVRTNGIPHPSALTGGKPAYS 407
                |..|.|..||                                 :..|.:..|  ||..::|
  Fly    92 ----GASPTGAAGA---------------------------------STAISNGGA--GGDYSHS 117

  Fly   408 FHMNGEGSLQPVPFPPDALVGVGIPRHARQ-----------INTLSHGEVVCAVTISNPTK--YV 459
            .|.:.......|    :|.:|.||..|:..           .|.:..|:.:|    .|..:  ||
  Fly   118 NHNSNSAGNNTV----EARLGGGISMHSMMNGGVVDQNGVATNQVLGGDRIC----FNFGRDLYV 174

  Fly   460 YTGGKGCVKVWDISQPGNK------NPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSI-- 516
            |: .:|..|..::|:|.:|      ||    .|  .|..|.|.  .|.|..|:||.....:.:  
  Fly   175 YS-FRGAKKGTEMSKPIDKKFYKGTNP----SC--HDFNISSA--TPTGAPLLVGFTTGQIQLVS 230

  Fly   517 ---------------------------WDLASPTPRIKA-----------ELTSAAPA------- 536
                                       |...||...:.|           ||..||.|       
  Fly   231 PHVGPREVRKLFNEERLIDKTKVTCLKWLPNSPHLFLAAHASGHLYLYNEELPCAATAPSYQPFK 295

  Fly   537 ------------------CYALAISPD----SKVCFSCC--------SDGNIAVWDLHNEILVRQ 571
                              .:....|.|    ::.|||.|        .||.:.|:......|:..
  Fly   296 LGDGYTILTSKSKTTRNPLFKWVFSTDNCCVNEFCFSPCGSHLAVVSQDGFLRVFHYDTMELLGI 360

  Fly   572 FQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGR 609
            .:.:..|..|:..||||..:..||.|:.|..|.|.|.|
  Fly   361 ARSYFGGFLCVCWSPDGKYIVVGGEDDLVTVWSLHERR 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 55/253 (22%)
WD40 repeat 447..486 CDD:293791 12/46 (26%)
WD40 repeat 494..532 CDD:293791 12/77 (16%)
WD40 repeat 537..573 CDD:293791 10/47 (21%)
WD40 repeat 580..615 CDD:293791 13/30 (43%)
WD40 repeat 620..653 CDD:293791
WD40 repeat 661..695 CDD:293791
WD40 repeat 702..726 CDD:293791
CG6420NP_001287545.1 WD40 <193..509 CDD:225201 44/214 (21%)
WD40 repeat 208..249 CDD:293791 6/42 (14%)
WD40 repeat 284..330 CDD:293791 5/45 (11%)
WD40 <297..417 CDD:295369 24/102 (24%)
WD40 repeat 369..404 CDD:293791 13/30 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.