DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and CG5466

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_650901.2 Gene:CG5466 / 42444 FlyBaseID:FBgn0038815 Length:594 Species:Drosophila melanogaster


Alignment Length:230 Identity:52/230 - (22%)
Similarity:75/230 - (32%) Gaps:57/230 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 SYGLNVEMH---------KQTEIAKRLNTLINQLLPFLQ----------ADHQQQVLQAVERAKQ 115
            |...|||:.         .|..:..:|..|..|....||          |.||||..|..::.:|
  Fly   246 SSSANVEIDLSKSTGAKVPQVPVPPQLQHLTKQQQSTLQTQLSQISAAAAHHQQQQQQQQQQQQQ 310

  Fly   116 VTMQELNLIIGHQQQHGIQQLLQQ--IHAQQ---------VPGGPPQPMGALNP-------FGAL 162
            ...|:......||||.....:.||  :.|||         .|....:....|:|       ..|.
  Fly   311 QQQQQQQAAAKHQQQLTAALIQQQNRVLAQQNLEKLSNHLSPLEKQRVFAQLDPKHFDPMAVAAA 375

  Fly   163 GATMGLPHGPQGLLNK-------PPEHHRPDIKPTGLEGPAAAEERLRN--------SVSPADRE 212
            .|.:.:    |||:..       ......|....|...|.|||..:..:        |.||....
  Fly   376 AANLQI----QGLMQSQAVAAAVAANQQTPAATTTSAAGGAAAGPQAHHGHHPLPPPSQSPHSSS 436

  Fly   213 KYRTRSPLDIENDSKRRKDEKLQEDEGEKSDQDLV 247
            ...:.|.|| :...|...|......:..:|::||:
  Fly   437 SSSSHSSLD-QITHKNVADSLRSNLDSIESNKDLL 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828 18/72 (25%)
WD40 442..727 CDD:238121
WD40 repeat 447..486 CDD:293791
WD40 repeat 494..532 CDD:293791
WD40 repeat 537..573 CDD:293791
WD40 repeat 580..615 CDD:293791
WD40 repeat 620..653 CDD:293791
WD40 repeat 661..695 CDD:293791
WD40 repeat 702..726 CDD:293791
CG5466NP_650901.2 DUF3736 100..221 CDD:289317
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1980
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.