DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and CG9799

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_650284.2 Gene:CG9799 / 41647 FlyBaseID:FBgn0038146 Length:922 Species:Drosophila melanogaster


Alignment Length:294 Identity:67/294 - (22%)
Similarity:109/294 - (37%) Gaps:63/294 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 YGRPPPMPYDPHAHVRTNGIPHPSALTGG---KPAYSFHMN--GEGSLQPVPFPPDALVGVGIPR 433
            :|.||.:.:.... .|.....:.:|:..|   ...:||..|  ||..|.|..|           :
  Fly   394 FGMPPILEFTSDT-AREKEWDNIAAIHAGVIQTTTWSFGKNRMGEHRLVPKQF-----------Q 446

  Fly   434 HARQINTLSHGEVVCAVTISNPTKYVYTG-GKGCVKVWDI---------SQPGNKNPVSQLDCLQ 488
            ::.:.|  ...|..| :.:::...:|..| ..|.::.::|         ..|.:|..|..   |.
  Fly   447 NSNRTN--FQNETTC-IVLTHCGNFVIIGYSSGDIERFNIQSGLHRATYGSPAHKMAVRG---LA 505

  Fly   489 RDNYIRSVKLLPDGRTLIVGGEASNLSIWDLASPTPRIKAELTSAAPACY--------ALAISPD 545
            .||.         .:|:|.|.....|..|.......:..|.|..|.....        .|||..:
  Fly   506 SDNL---------NQTVISGCSEGLLKFWSFKGKVDKPLATLRLADGIALIRQHRESSMLAIGLE 561

  Fly   546 SKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQ 610
            :...|         |.|:|..::||:|.|||...:.:..|||...|.|..:|:|::.||:.....
  Fly   562 TFKIF---------VVDMHTRVIVRKFVGHTAKLNDLTFSPDSRWLITAAMDSTIKVWDIPSSYM 617

  Fly   611 LQQHDFSSQIFSLGYCPTGDWLAVGMENSHVEVL 644
            :......:...||...|.||:||    .:||.:|
  Fly   618 VDHFRVEAPCVSLSMSPNGDFLA----TAHVGLL 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 52/221 (24%)
WD40 repeat 447..486 CDD:293791 8/48 (17%)
WD40 repeat 494..532 CDD:293791 7/37 (19%)
WD40 repeat 537..573 CDD:293791 9/43 (21%)
WD40 repeat 580..615 CDD:293791 9/34 (26%)
WD40 repeat 620..653 CDD:293791 10/25 (40%)
WD40 repeat 661..695 CDD:293791
WD40 repeat 702..726 CDD:293791
CG9799NP_650284.2 WD40 repeat 84..116 CDD:293791
WD40 111..372 CDD:295369
WD40 144..621 CDD:225201 57/262 (22%)
WD40 repeat 162..201 CDD:293791
WD40 repeat 206..242 CDD:293791
WD40 repeat 249..285 CDD:293791
WD40 repeat 291..331 CDD:293791
WD40 repeat 337..364 CDD:293791
WD40 repeat 408..447 CDD:293791 11/49 (22%)
WD40 458..652 CDD:295369 51/216 (24%)
WD40 repeat 458..496 CDD:293791 5/38 (13%)
WD40 repeat 502..540 CDD:293791 10/49 (20%)
WD40 repeat 545..580 CDD:293791 9/43 (21%)
WD40 repeat 587..622 CDD:293791 9/34 (26%)
Utp21 698..918 CDD:282098
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.