DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and CG3909

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_649969.1 Gene:CG3909 / 41226 FlyBaseID:FBgn0027524 Length:331 Species:Drosophila melanogaster


Alignment Length:296 Identity:73/296 - (24%)
Similarity:121/296 - (40%) Gaps:43/296 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   453 SNPTKYVYTGG-KGCVKVWDISQPGNKNPVSQLDCLQRDNYIR-------------SVKLLPDGR 503
            :.|..::.||| ...|||||               ||.||.::             ||.:..||:
  Fly    49 ARPKDFLVTGGLDDLVKVWD---------------LQEDNTLKLRHKLKGHALGVVSVAVSSDGQ 98

  Fly   504 TLIVGGEASNLSIWDLASPTPRIKAELTSAAPA-CYALAISPDSKVCFSCCSDGNIAVWDLH--- 564
            |:......|.:.:||..|..   |..|.|..|. .:.:..||.:|...|..:||.|:::.:.   
  Fly    99 TIASSSLDSTMCLWDARSGD---KKHLLSFGPVDLWTVQFSPCNKYVISGLNDGKISMYSVETGK 160

  Fly   565 -NEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQ-HDFSSQIFSLGYCP 627
             .:.|..|...:|   ..|..||||..:.:|.:|..:..:|:..|:.:|. ...:..:.||.:.|
  Fly   161 AEQTLDAQNGKYT---LSIAYSPDGKYIASGAIDGIITIFDVAAGKVVQTLEGHAMPVRSLCFSP 222

  Fly   628 TGDWLAVGMENSHVEVLHASKPDKY-QLHLHESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYGA 691
            ....|....::.|:::...:..|.. .|..|.|.||.:.|:..||.|.|:..||.:..|.|....
  Fly   223 NSQLLLTASDDGHMKLYDVTHSDVVGTLSGHASWVLCVAFSEDGKHFASSSSDNSVKIWDTSERK 287

  Fly   692 SIFQ-SKETSSVLSCDISTDDKYIVTGSGDKKATVY 726
            .:.. ::.|..|.....|..:..:.:.|.||...:|
  Fly   288 CLHTFAEHTDQVWGVRYSPGNDKVASASEDKSLNIY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 73/296 (25%)
WD40 repeat 447..486 CDD:293791 9/33 (27%)
WD40 repeat 494..532 CDD:293791 11/50 (22%)
WD40 repeat 537..573 CDD:293791 9/39 (23%)
WD40 repeat 580..615 CDD:293791 10/35 (29%)
WD40 repeat 620..653 CDD:293791 6/33 (18%)
WD40 repeat 661..695 CDD:293791 11/33 (33%)
WD40 repeat 702..726 CDD:293791 5/23 (22%)
CG3909NP_649969.1 WD40 52..323 CDD:238121 71/291 (24%)
WD40 <54..326 CDD:225201 72/291 (25%)
WD40 repeat 89..127 CDD:293791 12/40 (30%)
WD40 repeat 130..166 CDD:293791 7/35 (20%)
WD40 repeat 174..209 CDD:293791 10/34 (29%)
WD40 repeat 215..251 CDD:293791 6/35 (17%)
WD40 repeat 257..293 CDD:293791 11/35 (31%)
WD40 repeat 299..323 CDD:293791 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.