DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and Wdr33

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_730982.1 Gene:Wdr33 / 40698 FlyBaseID:FBgn0046222 Length:807 Species:Drosophila melanogaster


Alignment Length:420 Identity:81/420 - (19%)
Similarity:146/420 - (34%) Gaps:105/420 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 RPPPMPYDPHAHVRTNGIPHPSALTGGKPAYSFH----MNGEGSLQPVPFPP-----------DA 425
            :|||......:.:.||....|....||:....:|    .|..|..|..||.|           |.
  Fly     5 QPPPQLLTAPSALATNFTSLPPPNMGGQHYRHYHPHHGSNKHGYNQFKPFMPGGFQRPFGMSQDD 69

  Fly   426 LVGVGIPRHARQINTLSHGEVVCAVT-----------------------ISNPTKYVYTGGKGCV 467
            ..|..:.:...:.....:..::.|:.                       :..|:.|         
  Fly    70 FDGKRLRKSVMRKTVDYNASIIKALENRLYQRDYRDRLALQPDSIYVPHMLPPSAY--------- 125

  Fly   468 KVWDISQPGN-------KNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLASPTPR 525
                :..|.|       |...:::.|     .|.::...|:||.|:.|..:...::|:  ..|..
  Fly   126 ----LDNPSNAVTTRFVKTATNKMRC-----PIFTLAWTPEGRRLVTGASSGEFTLWN--GLTFN 179

  Fly   526 IKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVW--DLHNEILVRQFQGHTDGASCIDISPDG 588
            .:..|.:...:...:..|.:.....:....|.:..|  :::|   |:.:|.|.:....|..||..
  Fly   180 FETILQAHDISVRTMVWSHNDSWMVTGDHGGYVKYWQSNMNN---VKMYQAHKEAIRGISFSPTD 241

  Fly   589 SRLWTGGLDNTVRSWDL---REGRQLQQHDFSSQIFSLGYCPTGDWLAVGMENSHVEVLHASKPD 650
            |:..:|..|.|:|.||.   :|.|.|:.|  .:.:..:.:.|....:..|.:::       .:|.
  Fly   242 SKFVSGSDDGTLRIWDFMRCQEERVLRGH--GADVKCVHWHPQKGMIVSGSKDN-------QQPI 297

  Fly   651 KY----------QLHLHESCVLSLRFAACGKWFVSTGKDNLLNAW---RTPYGASIFQ--SKETS 700
            |.          .||.|:|.|:.|::...|.|.|:..:|:||..:   .......:|:  .||.|
  Fly   298 KIWDPKSGIALATLHAHKSTVMDLKWNDNGNWLVTASRDHLLKLFDIRNLREEVQVFRGHKKEAS 362

  Fly   701 SV--------LSCDISTDDKYIVTGSGDKK 722
            ||        |.|...:|...:....|..|
  Fly   363 SVSWHPIHEGLFCSGGSDGSILFWNVGTDK 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 64/339 (19%)
WD40 repeat 447..486 CDD:293791 6/68 (9%)
WD40 repeat 494..532 CDD:293791 8/37 (22%)
WD40 repeat 537..573 CDD:293791 5/37 (14%)
WD40 repeat 580..615 CDD:293791 13/37 (35%)
WD40 repeat 620..653 CDD:293791 4/42 (10%)
WD40 repeat 661..695 CDD:293791 8/36 (22%)
WD40 repeat 702..726 CDD:293791 6/29 (21%)
Wdr33NP_730982.1 WD40 146..429 CDD:238121 58/266 (22%)
WD40 148..>432 CDD:225201 57/259 (22%)
WD40 repeat 149..186 CDD:293791 9/38 (24%)
WD40 repeat 192..227 CDD:293791 5/37 (14%)
WD40 repeat 232..268 CDD:293791 12/35 (34%)
WD40 repeat 275..312 CDD:293791 4/43 (9%)
WD40 repeat 318..355 CDD:293791 8/36 (22%)
WD40 repeat 362..398 CDD:293791 8/31 (26%)
WD40 repeat 405..429 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.