DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and Rbbp5

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_649209.1 Gene:Rbbp5 / 40239 FlyBaseID:FBgn0036973 Length:489 Species:Drosophila melanogaster


Alignment Length:272 Identity:49/272 - (18%)
Similarity:83/272 - (30%) Gaps:105/272 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   537 CYALAISPDSKVCFSC------------CSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGS 589
            |.:||:        :|            |:||.|.:||.....:.:....|......:..:.:|.
  Fly    23 CISLAV--------TCAFNKYGTLLAVGCNDGRIVIWDFLTRGIAKIISAHVHPVCSLSWTRNGH 79

  Fly   590 RLWTGGLDNTVRSWDLREGRQLQQHDFSSQIFSLGYCPTGD---------WLAVGMENSHVEVLH 645
            :|.:...||.|..||:..|....::.|.|.:..:.:.|..|         :.||.:|   |...|
  Fly    80 KLLSASTDNNVCIWDVLTGELEHKYRFPSPVLKVQFDPRNDNRLLVCPMRYAAVLVE---VGGTH 141

  Fly   646 ASKP-------------DKYQLHLH------------------------------ESCVLSLRFA 667
            ...|             |:...|::                              .:.|.|:.||
  Fly   142 RCLPLDSDGDLNIVASFDRRGKHIYTGNAKGKILVLDVETFEVVASFRIIVGTSSATAVKSIEFA 206

  Fly   668 ACGKWFVSTGKDNLLNAWRTPYGASIFQSKETSSV---------------------LSCDISTDD 711
            ..|..|:....|.::.         ::.|||..::                     ..|..|.|.
  Fly   207 RRGDAFLINTSDRVIR---------VYDSKEIITLGKDGEPEPIQKLQDLVNKTTWKKCCFSGDG 262

  Fly   712 KYIVTGSGDKKA 723
            :||..||..:.|
  Fly   263 EYICAGSARQHA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 49/272 (18%)
WD40 repeat 447..486 CDD:293791
WD40 repeat 494..532 CDD:293791
WD40 repeat 537..573 CDD:293791 10/47 (21%)
WD40 repeat 580..615 CDD:293791 8/34 (24%)
WD40 repeat 620..653 CDD:293791 9/54 (17%)
WD40 repeat 661..695 CDD:293791 7/33 (21%)
WD40 repeat 702..726 CDD:293791 8/43 (19%)
Rbbp5NP_649209.1 WD40 28..321 CDD:295369 46/267 (17%)
WD40 repeat 29..64 CDD:293791 7/34 (21%)
WD40 <30..340 CDD:225201 46/257 (18%)
WD40 repeat 70..107 CDD:293791 8/36 (22%)
WD40 repeat 110..147 CDD:293791 8/39 (21%)
WD40 repeat 153..189 CDD:293791 2/35 (6%)
WD40 repeat 200..245 CDD:293791 10/53 (19%)
WD40 repeat 253..290 CDD:293791 8/22 (36%)
WD40 repeat 297..320 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.