| Sequence 1: | NP_996298.1 | Gene: | gro / 43162 | FlyBaseID: | FBgn0001139 | Length: | 730 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_957147.1 | Gene: | wdr61 / 393827 | ZFINID: | ZDB-GENE-040426-1851 | Length: | 305 | Species: | Danio rerio |
| Alignment Length: | 226 | Identity: | 58/226 - (25%) |
|---|---|---|---|
| Similarity: | 99/226 - (43%) | Gaps: | 23/226 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 436 RQINTLSHGEV-VCAVTISNPTKYVYTGGK-GCVKVWDISQPGNKNPVSQLDCLQRDNYIRSVKL 498
Fly 499 LPDGRTLIVGGEASNLSIWDLASPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDL 563
Fly 564 HNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQ-HDFSSQIFSLGYCP 627
Fly 628 TGDWLAVGMENSHVEVLHASKPDKYQLHLHE 658 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| gro | NP_996298.1 | TLE_N | 11..124 | CDD:397828 | |
| WD40 | 442..727 | CDD:238121 | 56/220 (25%) | ||
| WD40 repeat | 447..486 | CDD:293791 | 11/39 (28%) | ||
| WD40 repeat | 494..532 | CDD:293791 | 11/37 (30%) | ||
| WD40 repeat | 537..573 | CDD:293791 | 10/35 (29%) | ||
| WD40 repeat | 580..615 | CDD:293791 | 6/35 (17%) | ||
| WD40 repeat | 620..653 | CDD:293791 | 7/32 (22%) | ||
| WD40 repeat | 661..695 | CDD:293791 | |||
| WD40 repeat | 702..726 | CDD:293791 | |||
| wdr61 | NP_957147.1 | WD40 | <14..304 | CDD:225201 | 58/226 (26%) |
| WD 1 | 14..57 | ||||
| WD40 | 15..302 | CDD:238121 | 58/224 (26%) | ||
| WD40 repeat | 19..62 | CDD:293791 | |||
| WD 2 | 62..101 | 2/3 (67%) | |||
| WD40 repeat | 68..106 | CDD:293791 | 2/8 (25%) | ||
| WD 3 | 104..143 | 12/41 (29%) | |||
| WD40 repeat | 110..146 | CDD:293791 | 12/40 (30%) | ||
| WD 4 | 146..187 | 12/42 (29%) | |||
| WD40 repeat | 152..188 | CDD:293791 | 11/37 (30%) | ||
| WD 5 | 188..227 | 11/38 (29%) | |||
| WD40 repeat | 193..229 | CDD:293791 | 10/35 (29%) | ||
| WD 6 | 230..269 | 8/38 (21%) | |||
| WD40 repeat | 236..271 | CDD:293791 | 6/34 (18%) | ||
| WD 7 | 272..305 | 10/44 (23%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||