DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and tle5

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_956717.1 Gene:tle5 / 393395 ZFINID:ZDB-GENE-040426-1409 Length:197 Species:Danio rerio


Alignment Length:243 Identity:103/243 - (42%)
Similarity:136/243 - (55%) Gaps:47/243 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYPSPVRHPAAGGPPPQGPIKFTIADTLERIKEEFNFLQAQYHSIKLECEKLSNEKTEMQRHYVM 65
            |:|.. ||.|:     ...:|||.:|:.:|||:||.||||||||:||||:||::||:||||||:|
Zfish     2 MFPQS-RHSAS-----SQQLKFTTSDSCDRIKDEFQFLQAQYHSLKLECDKLASEKSEMQRHYIM 60

  Fly    66 YYEMSYGLNVEMHKQTEIAKRLNTLINQLLPFLQADHQQQVLQAVERAKQVTMQELNLIIGHQQQ 130
            |||||||||:|||||.||.||||.:..|:||:|..:||||||.|:|||||||..|:|.||..|.|
Zfish    61 YYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTPPEMNSIIRQQLQ 125

  Fly   131 HGIQQLLQQIHAQQVPGGPPQPMGALNPFGALGATMGLPHGPQGLLNKPPEHHRPDIKPTGLEGP 195
               ...|.|:....:| ..|.|:|...|.|....|     ...||.:              |...
Zfish   126 ---AHQLSQLQGLALP-MTPLPLGLSQPAGLPAVT-----SSSGLFS--------------LSSI 167

  Fly   196 AAAEERLRNSVSPADREKYRTRSPLDIENDSKRRKDEKLQEDEGEKSD 243
            .|::.:|..                  |:.|.|...:..:|::|:|||
Zfish   168 LASQAQLAK------------------EDKSTRETSDSHREEDGDKSD 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828 72/112 (64%)
WD40 442..727 CDD:238121
WD40 repeat 447..486 CDD:293791
WD40 repeat 494..532 CDD:293791
WD40 repeat 537..573 CDD:293791
WD40 repeat 580..615 CDD:293791
WD40 repeat 620..653 CDD:293791
WD40 repeat 661..695 CDD:293791
WD40 repeat 702..726 CDD:293791
tle5NP_956717.1 TLE_N 8..129 CDD:397828 78/128 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 182 1.000 Domainoid score I3389
eggNOG 1 0.900 - - E1_KOG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.