DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and CG10064

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_648065.1 Gene:CG10064 / 38761 FlyBaseID:FBgn0035724 Length:742 Species:Drosophila melanogaster


Alignment Length:333 Identity:77/333 - (23%)
Similarity:133/333 - (39%) Gaps:60/333 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   426 LVGVGIPRHARQINTLSHGEVVCAVTISNPTKYVY-TGGKGCVKVWDISQPGNKNP-----VSQL 484
            :.|:.|.....::....|.:.|..:|.......|: |.||.|:::|   ..|.|..     |...
  Fly   349 IYGLNIKTWVLKLLRTCHTKSVYCITFPKNYSGVFATSGKECIRIW---SSGRKQELLRIMVYNF 410

  Fly   485 DCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWD---LASPTPRIKAELTSAAP-----ACYALA 541
            :|       ..|:...||.:::        |:|:   :.:.|| |...|..|.|     .|.|||
  Fly   411 NC-------ACVRFTHDGTSIV--------SVWNDGIIRAFTP-ITGRLIYAIPNAHNKGCSALA 459

  Fly   542 ISPDSKVCFSCCSDGNIAVW--DLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWD 604
            ::...::..:...:|.:.||  |.:.:.||...:.|:...:.:||:...:.:.:...|.:...||
  Fly   460 VASSGRLIVTGGIEGQVRVWKIDPYRQDLVGVLKDHSGPITSLDINYLDTEVISACTDGSCVIWD 524

  Fly   605 LREGRQLQQHDFSSQIFSLGYCPTG-------------DWLAVGMENSHVEVLHASKPDKYQLHL 656
            ::...:.|....::|..|..|.|||             .|:.  ...:.:..|.|||        
  Fly   525 IKRMTRKQVVTANTQFMSASYFPTGVQVITCGSDGRIIYWMV--YNGALIRELTASK-------- 579

  Fly   657 HESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYGASI-FQSKETSSVLSCDISTDDKYIVTGSGD 720
             :|.|..|.....|.:|::.|.|..:..|....||.: ..|:..|||:||..|......||||.|
  Fly   580 -KSSVNCLAINETGDYFITVGSDLQVKLWDYNSGAVVGIGSEHASSVISCAYSPCMTMFVTGSTD 643

  Fly   721 KKATVYEV 728
            ....:::|
  Fly   644 GSLIIWDV 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 74/314 (24%)
WD40 repeat 447..486 CDD:293791 11/44 (25%)
WD40 repeat 494..532 CDD:293791 9/40 (23%)
WD40 repeat 537..573 CDD:293791 10/37 (27%)
WD40 repeat 580..615 CDD:293791 6/34 (18%)
WD40 repeat 620..653 CDD:293791 10/45 (22%)
WD40 repeat 661..695 CDD:293791 9/34 (26%)
WD40 repeat 702..726 CDD:293791 9/23 (39%)
CG10064NP_648065.1 WD40 <25..188 CDD:295369
WD40 33..434 CDD:225201 20/102 (20%)
WD40 repeat 65..106 CDD:293791
WD40 repeat 111..151 CDD:293791
WD40 repeat 159..186 CDD:293791
WD40 280..652 CDD:225201 77/333 (23%)
WD40 366..650 CDD:238121 74/313 (24%)
WD40 repeat 370..407 CDD:293791 10/39 (26%)
WD40 repeat 412..449 CDD:293791 11/52 (21%)
WD40 repeat 456..494 CDD:293791 9/37 (24%)
WD40 repeat 499..535 CDD:293791 6/35 (17%)
WD40 repeat 541..576 CDD:293791 6/36 (17%)
WD40 repeat 583..617 CDD:293791 9/33 (27%)
WD40 repeat 625..651 CDD:293791 9/25 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.