DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and Prp19

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_523783.1 Gene:Prp19 / 37123 FlyBaseID:FBgn0261119 Length:505 Species:Drosophila melanogaster


Alignment Length:305 Identity:72/305 - (23%)
Similarity:122/305 - (40%) Gaps:43/305 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 NGIPHPSALTGG--KPAYSFHMNGEGSLQPVPFPPDALVGVGIPRHARQINTLSHGEVVCAVTIS 453
            |...|...||||  |.|..|:.:.|           .:|.: :..|.::|..:          |.
  Fly   231 NSADHSKILTGGNDKNATVFNKDTE-----------QMVAI-LKGHTKKITKV----------IY 273

  Fly   454 NPTK-YVYTGGKGC-VKVWDISQPGNKNPVSQLDCLQR--DNYIRSVKLLPDGRTLIVGGEASNL 514
            :|.: .|.||.... :::|.:       |.||...|.|  :..:..:.|.|.|..|:......:.
  Fly   274 HPNEDTVITGSPDMNIRIWHV-------PTSQTQLLLRCHEGPVTGLSLHPTGDYLLSTSSDKHW 331

  Fly   515 SIWDLASPTPRIKAELTSAAPACYALA-ISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDG 578
            :..|:.  |.|:..::...|......| ..||..:..:...|..:.:|||..:..|..|.|||..
  Fly   332 AFSDIR--TGRLLTKVIDTAEVGLTTAQFHPDGLIFGTGTVDSQVKIWDLKEQSNVANFPGHTGP 394

  Fly   579 ASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQ--QHDFSSQIFSLGYCPTGDWLAVGMENSHV 641
            .|.|..|.:|..|.|...|..|:.||||:.:..:  |.|...::..|.:..:|.:||:.  .|.|
  Fly   395 ISAISFSENGYYLATAADDACVKLWDLRKLKNFKTIQLDDGYEVKDLCFDQSGTYLAIA--GSDV 457

  Fly   642 EVLHASKPDKYQL-HLHESCVLSLRFAACGKWFVSTGKDNLLNAW 685
            .|....:..:.:: :.|.:....:||....::..||..|..|..:
  Fly   458 RVYLCKQWQELKVFNDHTALATGVRFGKHAQYLASTSMDRTLKLY 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 59/252 (23%)
WD40 repeat 447..486 CDD:293791 9/40 (23%)
WD40 repeat 494..532 CDD:293791 7/37 (19%)
WD40 repeat 537..573 CDD:293791 8/36 (22%)
WD40 repeat 580..615 CDD:293791 13/36 (36%)
WD40 repeat 620..653 CDD:293791 7/32 (22%)
WD40 repeat 661..695 CDD:293791 6/25 (24%)
WD40 repeat 702..726 CDD:293791
Prp19NP_523783.1 Ubox 2..68 CDD:128780
Prp19 69..132 CDD:285771
WD40 210..503 CDD:238121 72/305 (24%)
WD40 <225..505 CDD:225201 72/305 (24%)
WD40 repeat 269..305 CDD:293791 10/52 (19%)
WD40 repeat 310..345 CDD:293791 7/36 (19%)
WD40 repeat 354..389 CDD:293791 8/34 (24%)
WD40 repeat 395..431 CDD:293791 12/35 (34%)
WD40 repeat 438..484 CDD:293791 9/47 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.