DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and wcd

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_611121.1 Gene:wcd / 36831 FlyBaseID:FBgn0262560 Length:506 Species:Drosophila melanogaster


Alignment Length:584 Identity:103/584 - (17%)
Similarity:187/584 - (32%) Gaps:167/584 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 PAAAEERLRNSVSP-------ADREKYRTRSPLDI-------------ENDSKRRKDEKLQEDEG 239
            |.|::.:..|.|..       .||::..|.....:             ||..:.:..:|.:....
  Fly    38 PKASQAKELNYVEVPMEKVLFGDRQRLLTNLAKSVGQKLPNDDEDEQEENPGQAKPGDKRKAAWS 102

  Fly   240 EKSDQDLVVDVANEMESHSPRPNGEHVSMEVRDRESLNG---ERLEKPSSSGIKQERPPSRSGSS 301
            :..|:||.|....:...|:...|  |:..:...:|.|..   ..|.:|..:..|.:.......||
  Fly   103 DSDDEDLQVGDVKKATKHTGPLN--HLRKDKSYKEYLTARFQRTLNQPKWAEKKVKNEDDEDVSS 165

  Fly   302 SSRSTPSLKTKDMEKPGTPG---AKARTPTPNAAAPAPGVNPKQMMPQGPPPAGYPGAPYQRPAD 363
                       |.|...|.|   .|||    |:..|...:|.|::....       .|.|     
  Fly   166 -----------DEELLRTVGFIDRKAR----NSDLPQKTLNFKRVKDLN-------RATY----- 203

  Fly   364 PYQRPPSDPAYGRPPPMPYDPHAHVRTNGIPHPSALTGGKPAYSFHMNGEGSLQPVPFPPDALVG 428
                     |.|....:.:.|.:         .:||..|       |||..::..|.        
  Fly   204 ---------AEGNATSIQFHPTS---------TAALVAG-------MNGLATIYAVD-------- 235

  Fly   429 VGIPRHARQINTLSHG------EVVCAVTISNPTKYVYTGGKGCVKVWDISQPGNKNPVSQLDCL 487
                   .|.|...|.      .:.|:......|:..:    |.||.:..|....:...|:|...
  Fly   236 -------GQKNERLHNMRFKKFPLACSRIAPCGTRAFF----GSVKPFYYSYDLLEAKESKLKLP 289

  Fly   488 QRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLASPTPRIKAELTSAAPACYALAISPDSKVCFSC 552
            ....::...::.|.|:.::..|:...:.:  |.:.|..:.......... .....|.|||....|
  Fly   290 GAMEFMHRFEVSPCGKFIVTAGKFGAIHL--LTAKTNELLHSFKQEGKV-KGFTWSSDSKRILVC 351

  Fly   553 CSDGNIAVWDLHNEILVRQF--QGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQHD 615
            .|..|::|.:|...::...|  .|...|.| |.:||:...|.||..:..|..:|       .:..
  Fly   352 GSTSNVSVLNLRQNLIEHIFMDDGCIHGES-IQLSPNQRLLATGSQEGVVNIYD-------YESI 408

  Fly   616 FSSQIFSLGYCPTGDWLAVGMENSHVEVLHASKPDKYQLHLHESCVLSLRF-------AACGKWF 673
            |:|:                          |.:|:|..::| .:.:..|:|       |.|    
  Fly   409 FASK--------------------------APQPEKRFMNL-RTAITDLQFNHSSELLAMC---- 442

  Fly   674 VSTGKDNLLNAWRTPY--GASIF-----QSKETSSVLSCDISTDDKYIVTGSGDKKATVYEVIY 730
                .....||::..:  .|:::     |:::...|.|...|....::...:..|:..::.:.|
  Fly   443 ----SSEAPNAFKLAHFPSATVYSNFPAQNEKVGFVTSMAFSPHSSFLAFATKGKQVPLFRLKY 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 53/306 (17%)
WD40 repeat 447..486 CDD:293791 8/38 (21%)
WD40 repeat 494..532 CDD:293791 5/37 (14%)
WD40 repeat 537..573 CDD:293791 10/37 (27%)
WD40 repeat 580..615 CDD:293791 9/34 (26%)
WD40 repeat 620..653 CDD:293791 3/32 (9%)
WD40 repeat 661..695 CDD:293791 7/47 (15%)
WD40 repeat 702..726 CDD:293791 4/23 (17%)
wcdNP_611121.1 WD40 <131..444 CDD:225201 77/429 (18%)
WD40 repeat 209..247 CDD:293791 11/68 (16%)
WD40 296..>504 CDD:295369 45/253 (18%)
WD40 repeat 298..332 CDD:293791 5/35 (14%)
WD40 repeat 337..371 CDD:293791 9/33 (27%)
WD40 repeat 376..415 CDD:293791 13/72 (18%)
WD40 repeat 428..465 CDD:293791 7/44 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.