DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and CG9062

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001260886.1 Gene:CG9062 / 36199 FlyBaseID:FBgn0033607 Length:680 Species:Drosophila melanogaster


Alignment Length:372 Identity:82/372 - (22%)
Similarity:147/372 - (39%) Gaps:67/372 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   409 HMNGEGSLQ-------PVPFPPDALVGVGIPR---HARQINTLSHGE------VVCAVTISNPTK 457
            |.||..:||       ......||::.|...|   ..:.|.::.|..      |:|.    |...
  Fly    27 HRNGVNALQLDANNGKLYSAGRDAIIRVWNTRTDSSEKYIQSMEHHNDWVNDIVLCC----NGRN 87

  Fly   458 YVYTGGKGCVKVWDISQPGNKNPVSQLDCL-----QRDNYIRSVKLLPDGRTLIVGGEASNLSIW 517
            .:.......||||: :|.|        .|:     .|| |::::....|...:...|....:.:|
  Fly    88 LISASCDTTVKVWN-AQKG--------FCMSTLRTHRD-YVQALAYAKDREQVASAGLDKAIFLW 142

  Fly   518 DL-------ASPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGH 575
            |:       ||......:.||.:..:.|:||::|...|..|..::..:.:||....:...:.:||
  Fly   143 DVNTLTALTASNNTVTTSSLTGSKDSIYSLAMNPSGTVIVSGSTENILRIWDPRTCMRRMKLRGH 207

  Fly   576 TDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQ-HDFSSQIFSLGYCPTGDWLAVGMENS 639
            |:...|:.:||||:::.:|..|.|::.|:|.:.|.:|. |.....::||.......::..|..:.
  Fly   208 TENVRCLVVSPDGNQVVSGSSDGTIKVWNLGQQRCVQTIHVHKEGVWSLLMSENFQYIISGSRDR 272

  Fly   640 HVEVLHASKPDKYQLHLHESC-VLSLRF--AACGKWFVSTGKDNLLNAWRTPY------------ 689
            ::.|.....|....|...|.. ||||.:  ...|.|..:...|  :..|:.|.            
  Fly   273 NIIVTEMRNPSNKTLVCEEQAPVLSLGYNIDKTGVWATTWNSD--IRCWKLPMYDRCTLNSSGGM 335

  Fly   690 -------GASIFQSKETSSVLSCDISTDDKYIVTGSGDKKATVYEVI 729
                   |..:...|..:::..|.:..|.:||:|.....:..||:|:
  Fly   336 DAQWTQGGTEVACIKGGAAIKECAVLNDKRYIITKDSQDQVVVYDVL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 70/325 (22%)
WD40 repeat 447..486 CDD:293791 8/38 (21%)
WD40 repeat 494..532 CDD:293791 7/44 (16%)
WD40 repeat 537..573 CDD:293791 8/35 (23%)
WD40 repeat 580..615 CDD:293791 12/35 (34%)
WD40 repeat 620..653 CDD:293791 5/32 (16%)
WD40 repeat 661..695 CDD:293791 10/54 (19%)
WD40 repeat 702..726 CDD:293791 5/23 (22%)
CG9062NP_001260886.1 WD40 <24..332 CDD:225201 72/320 (23%)
WD40 27..320 CDD:238121 70/308 (23%)
WD40 repeat 77..113 CDD:293791 10/48 (21%)
WD40 repeat 118..158 CDD:293791 6/39 (15%)
WD40 repeat 170..205 CDD:293791 8/34 (24%)
WD40 repeat 211..247 CDD:293791 12/35 (34%)
WD40 repeat 253..288 CDD:293791 5/34 (15%)
WD40 repeat 295..319 CDD:293791 7/25 (28%)
DUF3337 492..658 CDD:288649
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.