DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and l(2)k09848

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001188867.1 Gene:l(2)k09848 / 35536 FlyBaseID:FBgn0284246 Length:419 Species:Drosophila melanogaster


Alignment Length:257 Identity:57/257 - (22%)
Similarity:107/257 - (41%) Gaps:59/257 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 HARQINTLSHGEVVCAVTISNPTKY---VYTG-GKGCVKVWDISQPGNKNPV-----SQLDCLQR 489
            |:|  ||:|..    |..|....:|   :..| |.|.::..::.......||     .|:|.|::
  Fly    89 HSR--NTVSFN----AAPIVGLARYNDKLIAGIGNGEIQSLELEANDESEPVVIATGDQMDHLRQ 147

  Fly   490 DNYIRSVKLLPDGRTLIVGGE--ASNLSIWDLASPTPRIKAELTSA-APACYALAISP--DSKVC 549
            ...::|:        :..||:  .:||.::||.:...:|   .||. .|..|.....|  ||.:.
  Fly   148 CAQVKSI--------VATGGKERQNNLKVYDLNADGKQI---FTSKNLPNDYLQLEVPVWDSDIG 201

  Fly   550 F--------SCCSDGNIAVWDLHNEIL-VRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDL 605
            |        :|...|.:.::|...:.. |..|.....|.|...:...|:.::||.....::::|.
  Fly   202 FVDGPSVLATCSRTGYVRIYDTRKQRRPVACFASEEHGMSFTTLVAKGNFIYTGTTMGALKAFDT 266

  Fly   606 REGRQLQQHDFSSQIFSLGYCPTGDWLAVGMENSHVEV----LHASKPDKY-QLHLHESCVL 662
               |:::.|..:.:.|      ||     |:.:.|::.    |.::..|:| ::|..|:.||
  Fly   267 ---RRMKTHVHTYKGF------TG-----GISDLHLDATGRFLSSASLDRYVRIHDSETTVL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 53/249 (21%)
WD40 repeat 447..486 CDD:293791 9/47 (19%)
WD40 repeat 494..532 CDD:293791 8/39 (21%)
WD40 repeat 537..573 CDD:293791 9/46 (20%)
WD40 repeat 580..615 CDD:293791 6/34 (18%)
WD40 repeat 620..653 CDD:293791 8/37 (22%)
WD40 repeat 661..695 CDD:293791 2/2 (100%)
WD40 repeat 702..726 CDD:293791
l(2)k09848NP_001188867.1 WD40 36..>327 CDD:225201 57/257 (22%)
WD40 55..318 CDD:295369 57/257 (22%)
WD40 repeat 146..184 CDD:293791 10/48 (21%)
WD40 repeat 240..277 CDD:293791 7/39 (18%)
WD40 repeat 283..309 CDD:293791 5/25 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.