DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and Oseg5

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_610064.2 Gene:Oseg5 / 35349 FlyBaseID:FBgn0032891 Length:775 Species:Drosophila melanogaster


Alignment Length:291 Identity:60/291 - (20%)
Similarity:100/291 - (34%) Gaps:77/291 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 GGKGCVKVWDISQPG-----NKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLAS 521
            ||||...:...|..|     ||:...:.........|.|.:..|||..|:..||...:.||   |
  Fly    88 GGKGSDTLLICSNDGRFVILNKSARVERSISAHAAAISSGRWSPDGAGLLTAGEDGVIKIW---S 149

  Fly   522 PTPRIKAELTSAAPACYALAISPDS-KVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDIS 585
            .:..:::.:.....:......:|:| .:.|  |..|:|::..|.....:.:::.|......:..|
  Fly   150 RSGMLRSTVVQNEESIRCARWAPNSNSIVF--CQGGHISIKPLAANSKIIRWRAHDGLVLSLSWS 212

  Fly   586 PDGSRLWTGGLDNTVRSWDLREGRQLQQHDFSS-----QIFSLGYCPTGDWLAVGMENSHVEVLH 645
            ...:.:.:||.|...:.|| .:|..|    |:|     .|.|:.:.|..|:|.||..|. :::.|
  Fly   213 TQSNIIASGGEDFRFKIWD-AQGANL----FTSAAEEYAITSVAFNPEKDYLLVGTFNL-LKLCH 271

  Fly   646 ASKPDKYQLHLHESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKETSSVLSCDISTD 710
            :                                    |.|  .|..:.|.|....|:.:...|.|
  Fly   272 S------------------------------------NGW--SYNTARFSSPRVGSIFNLSWSAD 298

  Fly   711 DKYIVTG-----------------SGDKKAT 724
            ......|                 ||:.|||
  Fly   299 GTQATCGTSTGQLIVAYAIEQQLVSGNLKAT 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 60/291 (21%)
WD40 repeat 447..486 CDD:293791 8/28 (29%)
WD40 repeat 494..532 CDD:293791 10/37 (27%)
WD40 repeat 537..573 CDD:293791 7/36 (19%)
WD40 repeat 580..615 CDD:293791 8/34 (24%)
WD40 repeat 620..653 CDD:293791 9/32 (28%)
WD40 repeat 661..695 CDD:293791 3/33 (9%)
WD40 repeat 702..726 CDD:293791 8/40 (20%)
Oseg5NP_610064.2 WD40 12..347 CDD:225201 60/291 (21%)
WD40 <28..149 CDD:295369 18/63 (29%)
WD40 repeat 32..69 CDD:293791
WD40 115..>313 CDD:295369 47/246 (19%)
WD40 repeat 125..160 CDD:293791 10/37 (27%)
WD40 repeat 165..199 CDD:293791 7/35 (20%)
WD40 repeat 207..240 CDD:293791 9/37 (24%)
WD40 repeat 247..283 CDD:293791 12/74 (16%)
WD40 repeat 313..350 CDD:293791 5/17 (29%)
WD40 repeat 354..384 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.