DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and CG4935

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_609782.2 Gene:CG4935 / 34955 FlyBaseID:FBgn0028897 Length:308 Species:Drosophila melanogaster


Alignment Length:281 Identity:73/281 - (25%)
Similarity:113/281 - (40%) Gaps:57/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   477 NKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLASPTPRIKA------ELTSAAP 535
            |.|..:.:||.|  ..:|:|:...||...:..|....:.:|:.||.. .:|.      |:|.||.
  Fly     6 NFNVKTTIDCKQ--GAVRAVRYNVDGTYCLSCGSDKKIKLWNPASGL-LLKTYGGHADEVTDAAG 67

  Fly   536 ACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTV 600
            :|       ||....|...|.:|..||:.....||:.:.|..|..|:..:.|.|...:||.||.|
  Fly    68 SC-------DSSYIVSASLDKSIIYWDVSTGAPVRRLRSHAGGVRCVCFNEDSSIAISGGRDNAV 125

  Fly   601 RSWDLREGR----QLQQH---------DFSSQIF--SLGYCPTGDWLAVGMENSHVEVLHASKPD 650
            ..||:|..|    |:.:.         ...::|:  ||..|.....:.||    .:......:|.
  Fly   126 MCWDIRTRRLDPVQVMKEARDCITTVATNENRIYAASLDGCVRTYDIRVG----ELTCDKIGEPI 186

  Fly   651 KYQLHLH-ESCVLS------LRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKETSSVLSCDIS 708
            .|..... |.|:::      :|...|     .||  .||:.:|...|....        :.|.|.
  Fly   187 TYLAQTRDEQCLVAGCQDSVVRLLDC-----ETG--GLLSEYRGHRGDDYH--------IECGIL 236

  Fly   709 TDDKYIVTGSGDKKATVYEVI 729
            ::|..|||||.|..|.||:::
  Fly   237 SNDAQIVTGSSDGDAFVYDLL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 72/277 (26%)
WD40 repeat 447..486 CDD:293791 2/8 (25%)
WD40 repeat 494..532 CDD:293791 10/43 (23%)
WD40 repeat 537..573 CDD:293791 10/35 (29%)
WD40 repeat 580..615 CDD:293791 13/47 (28%)
WD40 repeat 620..653 CDD:293791 7/34 (21%)
WD40 repeat 661..695 CDD:293791 8/39 (21%)
WD40 repeat 702..726 CDD:293791 10/23 (43%)
CG4935NP_609782.2 WD40 10..>302 CDD:225201 71/277 (26%)
WD40 10..281 CDD:238121 71/277 (26%)
WD40 repeat 21..57 CDD:293791 9/36 (25%)
WD40 repeat 62..98 CDD:293791 13/42 (31%)
WD40 repeat 105..135 CDD:293791 11/29 (38%)
WD40 repeat 140..178 CDD:293791 6/41 (15%)
WD40 repeat 186..222 CDD:293791 9/42 (21%)
WD40 repeat 229..254 CDD:293791 10/32 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.