DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and CG9175

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_608995.2 Gene:CG9175 / 33862 FlyBaseID:FBgn0031779 Length:445 Species:Drosophila melanogaster


Alignment Length:310 Identity:72/310 - (23%)
Similarity:111/310 - (35%) Gaps:84/310 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   476 GNKNPVSQLDCLQRDNYI----------------------RSVKLLPDGRTLIVGGEASNLSIWD 518
            |::.|:|..|.|::...:                      |.|::..:||.:..||....|.:|.
  Fly   150 GHRPPLSTADILRQFRRLHFDIQAADVIQTDFLKGAEPLQRVVRISGNGRLMATGGTDGKLRVWT 214

  Fly   519 LASPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHT-DGAS-- 580
            .  |...:.|||.:.:.....|..|||||:..|...|....||||.:..|..:.|..| :||.  
  Fly   215 F--PQMTLAAELAAHSKEIDDLDFSPDSKLIASISKDAQGLVWDLASGQLQHKLQWKTPEGAKYL 277

  Fly   581 ---C----IDISPDGSRLWT--------GGLDNTVRSWDLREGRQLQQHDFSSQIFSLGYCPTGD 630
               |    ::...|..||:|        |.....::.||...|:..|.......:.||.....|.
  Fly   278 FKRCRYGTVEAQKDNYRLFTIANPLGKVGKQRGFLQHWDCASGQLRQAVAIDESLSSLAVRDDGR 342

  Fly   631 WLAVG-MENSHV---------EVLHASKPDKYQLHLHESCVLSLRFAACGKWFVSTGKDNLLNAW 685
            ::||| |.:..|         .|||..       |.|...|..|:|..            :.|..
  Fly   343 FVAVGTMFSGSVSMYIAFSLQRVLHIP-------HAHSMFVTGLQFLP------------ITNEE 388

  Fly   686 RTPYGASIFQSKETSSVLSCDISTDDKYIVTGSGDKK------ATVYEVI 729
            ..|     ..|...::|||  ||.|:|..:.....::      |.|:.::
  Fly   389 GPP-----ISSDTEAAVLS--ISVDNKVCIHSLSQRRTIPAWIAIVFLIV 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 72/306 (24%)
WD40 repeat 447..486 CDD:293791 3/9 (33%)
WD40 repeat 494..532 CDD:293791 12/37 (32%)
WD40 repeat 537..573 CDD:293791 13/35 (37%)
WD40 repeat 580..615 CDD:293791 10/51 (20%)
WD40 repeat 620..653 CDD:293791 11/42 (26%)
WD40 repeat 661..695 CDD:293791 5/33 (15%)
WD40 repeat 702..726 CDD:293791 8/29 (28%)
CG9175NP_608995.2 WD40 <190..>421 CDD:225201 65/258 (25%)
WD40 190..>420 CDD:295369 65/257 (25%)
WD40 repeat 190..226 CDD:293791 12/37 (32%)
WD40 repeat 231..267 CDD:293791 13/35 (37%)
WD40 repeat 296..327 CDD:293791 6/30 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.