DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and Nle

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_477294.2 Gene:Nle / 33234 FlyBaseID:FBgn0021874 Length:488 Species:Drosophila melanogaster


Alignment Length:345 Identity:78/345 - (22%)
Similarity:126/345 - (36%) Gaps:75/345 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 HGEVVCAVTISNPTKYVYTG-GKGCVKVWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLI 506
            |.|.|.::..|....::.:| |...|::||::   .:.|  ...|.....::..|...|||:.|.
  Fly   118 HAEAVVSLNFSPDGAHLASGSGDTTVRLWDLN---TETP--HFTCTGHKQWVLCVSWAPDGKRLA 177

  Fly   507 VGGEASNLSIWD------LASPTPRIKAELTSAA-------PACYALAISPDSKVCFSCCSDGNI 558
            .|.:|.::.|||      ...|....|..:...|       |.|..||         |...||:.
  Fly   178 SGCKAGSIIIWDPETGQQKGRPLSGHKKHINCLAWEPYHRDPECRKLA---------SASGDGDC 233

  Fly   559 AVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREG---RQLQQHD--FSS 618
            .:||:.....:....|||:..:.:.....| .::|...|.||:.|...:|   |....|.  .::
  Fly   234 RIWDVKLGQCLMNIAGHTNAVTAVRWGGAG-LIYTSSKDRTVKMWRAADGILCRTFSGHAHWVNN 297

  Fly   619 QIFSLGY-CPTGDWLAV-GMENSHV----EVLHASKPDKYQ------------------LHL--- 656
            ...|..| ..||.:..| ....||:    |.|..|...:||                  |:|   
  Fly   298 IALSTDYVLRTGPFHPVKDRSKSHLSLSTEELQESALKRYQAVCPDEVESLVSCSDDNTLYLWRN 362

  Fly   657 -----------HESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYG--ASIFQSKETSSVLSCDIS 708
                       |::.|..::::...|...|...|..:..||...|  .:.|:. ...:|.:...|
  Fly   363 NQNKCVERMTGHQNVVNDVKYSPDVKLIASASFDKSVRLWRASDGQYMATFRG-HVQAVYTVAWS 426

  Fly   709 TDDKYIVTGSGDKKATVYEV 728
            .|.:.||:||.|....|:.|
  Fly   427 ADSRLIVSGSKDSTLKVWSV 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 77/342 (23%)
WD40 repeat 447..486 CDD:293791 8/39 (21%)
WD40 repeat 494..532 CDD:293791 12/43 (28%)
WD40 repeat 537..573 CDD:293791 8/35 (23%)
WD40 repeat 580..615 CDD:293791 8/37 (22%)
WD40 repeat 620..653 CDD:293791 10/38 (26%)
WD40 repeat 661..695 CDD:293791 7/35 (20%)
WD40 repeat 702..726 CDD:293791 8/23 (35%)
NleNP_477294.2 NLE 22..82 CDD:285380
WD40 110..147 CDD:278812 7/28 (25%)
WD40 112..486 CDD:225201 78/345 (23%)
WD40 repeat 123..159 CDD:293791 8/40 (20%)
WD40 153..487 CDD:238121 69/307 (22%)
WD40 repeat 164..202 CDD:293791 11/37 (30%)
WD40 repeat 208..249 CDD:293791 10/49 (20%)
WD40 repeat 254..289 CDD:293791 8/35 (23%)
WD40 repeat 296..372 CDD:293791 14/75 (19%)
WD40 repeat 378..414 CDD:293791 7/35 (20%)
WD40 repeat 420..456 CDD:293791 10/27 (37%)
WD40 repeat 462..486 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.