DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and CG3436

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001285543.1 Gene:CG3436 / 33180 FlyBaseID:FBgn0031229 Length:347 Species:Drosophila melanogaster


Alignment Length:260 Identity:58/260 - (22%)
Similarity:113/260 - (43%) Gaps:14/260 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   480 PVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLASPTPRIKAELTSAAPACYALAISP 544
            |:.||:  ..:..|.:.:..|:|..|:..|....:.||.:......:.| ::..:.|......:|
  Fly    47 PIMQLE--GHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYEDCENVMA-MSGHSGAVMEAHFTP 108

  Fly   545 DSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDN-TVRSWDLREG 608
            |....|:|.:|..:|.||:......|:|:||.:..:.:..|..|.:|...|.|: |::.||.|:.
  Fly   109 DGSHIFTCSTDKTLAFWDIATGQRQRRFKGHGNFVNSVQGSRRGQQLLCSGSDDRTIKIWDARKK 173

  Fly   609 RQLQQHDFSSQIFSLGYCPTGDWLAVGMENSHVEVLHASKPD-KYQLHLHESCVLSLRFAACGKW 672
            ......:...|:.::.:..||:.:..|..::.|::....|.. .:.|..|...:..:..:..|.:
  Fly   174 HAAHTLESPFQVTAVCFGDTGEQVISGGIDNEVKIWDIRKQAVLHHLRGHSDTITGMSLSPEGDF 238

  Fly   673 FVSTGKDNLLNAWRT-PYG-----ASIFQSKE---TSSVLSCDISTDDKYIVTGSGDKKATVYEV 728
            .::...||.|..|.. ||.     ..:||..:   ..::|.|..|.....|.:||.|:...:::|
  Fly   239 ILTNAMDNTLRVWDVRPYAPGERCVKVFQGHQHNFEKNLLRCAWSPGSDKITSGSADRHVYIWDV 303

  Fly   729  728
              Fly   304  303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 57/257 (22%)
WD40 repeat 447..486 CDD:293791 3/5 (60%)
WD40 repeat 494..532 CDD:293791 7/37 (19%)
WD40 repeat 537..573 CDD:293791 9/35 (26%)
WD40 repeat 580..615 CDD:293791 9/35 (26%)
WD40 repeat 620..653 CDD:293791 5/33 (15%)
WD40 repeat 661..695 CDD:293791 7/39 (18%)
WD40 repeat 702..726 CDD:293791 7/23 (30%)
CG3436NP_001285543.1 WD40 <19..346 CDD:225201 58/260 (22%)
WD40 50..342 CDD:238121 57/257 (22%)
WD40 repeat 58..96 CDD:293791 8/38 (21%)
WD40 repeat 102..138 CDD:293791 10/35 (29%)
WD40 repeat 143..180 CDD:293791 9/36 (25%)
WD40 repeat 186..221 CDD:293791 5/34 (15%)
WD40 repeat 227..267 CDD:293791 7/39 (18%)
WD40 repeat 277..313 CDD:293791 8/27 (30%)
WD40 repeat 319..342 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.