DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and AgaP_AGAP007626

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:XP_564611.3 Gene:AgaP_AGAP007626 / 3290403 VectorBaseID:AGAP007626 Length:336 Species:Anopheles gambiae


Alignment Length:288 Identity:65/288 - (22%)
Similarity:122/288 - (42%) Gaps:34/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 YVYTGG-KGCVKVWDISQPGNKNPVSQLDCLQRDNY------IRSVKLLPDGRTLIVGGEASNLS 515
            ::.||| ...||:||:....:|..:       |:.:      :.||.:...|..:......|:|.
Mosquito    59 FIVTGGVDDTVKIWDVLPDRSKFKL-------RNTFTGHSLGVVSVDVSTSGEVIASSSLDSSLC 116

  Fly   516 IWDLASPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLH----NEILVRQFQGHT 576
            ||  .:.|.::..:::......:.:|.||..|...|...:|.|:::.:.    .::|..|     
Mosquito   117 IW--KAETGQLMNQISVGPVDLWTVAFSPCDKYIISGSHEGKISLYSVETGKAEQVLDPQ----- 174

  Fly   577 DGASCIDI--SPDGSRLWTGGLDNTVRSWDLREGR---QLQQHDFSSQIFSLGYCPTGDWLAVGM 636
            :|...:.|  ||||..:.:|.:|..:..:|:..|:   .|:.|..|  :.||.:.|....|....
Mosquito   175 NGKFTLSIAYSPDGKYIASGAIDGIINIFDVAAGKVAQTLEGHAMS--VRSLCFSPDSQMLLTAS 237

  Fly   637 ENSHVEVLHASKPDKY-QLHLHESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQ-SKET 699
            ::.|:::...:..|.. .|..|.|.|||:.|:..||.|.|:..|..:..|.......:.. ::..
Mosquito   238 DDGHMKLYDVAHSDVVGTLSGHASWVLSVSFSGDGKNFASSSSDKTVKIWNVAERQCLHTFTEHA 302

  Fly   700 SSVLSCDISTDDKYIVTGSGDKKATVYE 727
            ..|.....|.|...:::.|.||...:|:
Mosquito   303 DQVWGVRYSPDSANVISVSEDKCINMYD 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 64/286 (22%)
WD40 repeat 447..486 CDD:293791 8/28 (29%)
WD40 repeat 494..532 CDD:293791 8/37 (22%)
WD40 repeat 537..573 CDD:293791 9/39 (23%)
WD40 repeat 580..615 CDD:293791 10/39 (26%)
WD40 repeat 620..653 CDD:293791 6/33 (18%)
WD40 repeat 661..695 CDD:293791 10/33 (30%)
WD40 repeat 702..726 CDD:293791 6/23 (26%)
AgaP_AGAP007626XP_564611.3 WD40 58..>332 CDD:225201 65/288 (23%)
WD40 58..330 CDD:238121 64/286 (22%)
WD40 repeat 95..133 CDD:293791 8/39 (21%)
WD40 repeat 136..172 CDD:293791 7/35 (20%)
WD40 repeat 180..215 CDD:293791 9/34 (26%)
WD40 repeat 221..257 CDD:293791 6/35 (17%)
WD40 repeat 263..299 CDD:293791 10/35 (29%)
WD40 repeat 305..329 CDD:293791 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.