DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and Gbeta13F

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001303567.1 Gene:Gbeta13F / 32544 FlyBaseID:FBgn0001105 Length:340 Species:Drosophila melanogaster


Alignment Length:290 Identity:66/290 - (22%)
Similarity:116/290 - (40%) Gaps:55/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   465 GCVKVWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLAS--PTPRIK 527
            |.:.||| |...||.....|    |.:::.:....|.|..:..||..:..||::|.:  ...|:.
  Fly    77 GKLIVWD-SHTTNKVHAIPL----RSSWVMTCAYAPSGSYVACGGLDNMCSIYNLKTREGNVRVS 136

  Fly   528 AELTSAAPACYALAISPDSKVCFSCC----------SDGNIA--VWDLHNEILVRQFQGHTDGAS 580
            .||             |......|||          |.|:::  :||:...:.|..|.|||....
  Fly   137 REL-------------PGHGGYLSCCRFLDDNQIVTSSGDMSCGLWDIETGLQVTSFLGHTGDVM 188

  Fly   581 CIDISPDGSRLWTGGLDNTVRSWDLREG---RQLQQHDFSSQIFSLGYCPTGDWLAVGMENSHVE 642
            .:.::|......:|..|.:.:.||:|||   :....|:  |.|.::.:.|.|...|.|.:::...
  Fly   189 ALSLAPQCKTFVSGACDASAKLWDIREGVCKQTFPGHE--SDINAVTFFPNGQAFATGSDDATCR 251

  Fly   643 VLHASKPDKYQLHLHES--C-VLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKETSSVL- 703
            :.......:..::.|::  | :.|:.|:..|:..::...|...|.|.|       ...|.|.:| 
  Fly   252 LFDIRADQELAMYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDT-------MKAERSGILA 309

  Fly   704 ------SC-DISTDDKYIVTGSGDKKATVY 726
                  || .::.:...:.|||.|....|:
  Fly   310 GHDNRVSCLGVTENGMAVATGSWDSFLRVW 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 66/290 (23%)
WD40 repeat 447..486 CDD:293791 8/20 (40%)
WD40 repeat 494..532 CDD:293791 10/39 (26%)
WD40 repeat 537..573 CDD:293791 9/47 (19%)
WD40 repeat 580..615 CDD:293791 8/37 (22%)
WD40 repeat 620..653 CDD:293791 5/32 (16%)
WD40 repeat 661..695 CDD:293791 7/33 (21%)
WD40 repeat 702..726 CDD:293791 7/31 (23%)
Gbeta13FNP_001303567.1 WD40 48..340 CDD:238121 66/290 (23%)
WD40 repeat 58..95 CDD:293791 7/18 (39%)
WD40 repeat 101..141 CDD:293791 10/52 (19%)
WD40 repeat 146..181 CDD:293791 8/34 (24%)
WD40 repeat 188..223 CDD:293791 8/34 (24%)
WD40 repeat 229..265 CDD:293791 5/35 (14%)
WD40 repeat 273..309 CDD:293791 9/42 (21%)
WD40 repeat 315..339 CDD:293791 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.