DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and Tango4

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster


Alignment Length:234 Identity:62/234 - (26%)
Similarity:98/234 - (41%) Gaps:12/234 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   492 YIRSVKLLPDGRTLIVGGEASNLSIWDLASPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDG 556
            ::|.:.:.|.......|.....:.||||||  .::|..||........:|:|......|||..|.
  Fly   174 WVRCIAVEPGNEWFATGAGDRVIKIWDLAS--GKLKLSLTGHVSTVRGVAVSTKHPYLFSCGEDR 236

  Fly   557 NIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLR---EGRQLQQHDFSS 618
            .:..|||....::|.:.||......:.:.|....|.|.|.|:|.|.||:|   ....|..|  ::
  Fly   237 QVKCWDLEYNKVIRHYHGHLSAVYSLALHPTIDVLATSGRDSTARIWDMRTKANVHTLTGH--TN 299

  Fly   619 QIFSLGYCPTGDWLAVGMENSHVEV--LHASKPDKYQLHLHESCVLSLRFAACGKWFVSTGKDNL 681
            .:.|:....|...:..|..:|.|.:  |.|.| ....|..|:..|.|:........|.|...|| 
  Fly   300 TVASVVAQATNPQIITGSHDSTVRLWDLAAGK-SVCTLTNHKKSVRSIVLHPSLYMFASASPDN- 362

  Fly   682 LNAWRTPYGASIFQSKETSSVLSCDISTDDKYIVTGSGD 720
            :..||.|.|..:......:|:::|..:..:..:|:| ||
  Fly   363 IKQWRCPEGKFVQNISGHTSIVNCMAANSEGVLVSG-GD 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 62/234 (26%)
WD40 repeat 447..486 CDD:293791
WD40 repeat 494..532 CDD:293791 11/37 (30%)
WD40 repeat 537..573 CDD:293791 10/35 (29%)
WD40 repeat 580..615 CDD:293791 11/37 (30%)
WD40 repeat 620..653 CDD:293791 8/34 (24%)
WD40 repeat 661..695 CDD:293791 10/33 (30%)
WD40 repeat 702..726 CDD:293791 5/19 (26%)
Tango4NP_572778.1 WD40 <161..458 CDD:225201 62/234 (26%)
WD40 164..458 CDD:238121 62/234 (26%)
WD40 repeat 177..212 CDD:293791 10/36 (28%)
WD40 repeat 218..254 CDD:293791 10/35 (29%)
WD40 repeat 259..295 CDD:293791 10/35 (29%)
WD40 repeat 302..337 CDD:293791 8/35 (23%)
WD40 repeat 343..378 CDD:293791 10/35 (29%)
WD40 repeat 386..426 CDD:293791 5/16 (31%)
WD40 repeat 433..457 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.