DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and Gbeta5

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_572452.1 Gene:Gbeta5 / 31744 FlyBaseID:FBgn0030011 Length:358 Species:Drosophila melanogaster


Alignment Length:302 Identity:62/302 - (20%)
Similarity:117/302 - (38%) Gaps:36/302 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   445 EVVCAVTISNPTKYVYTGGKGCVKVWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGG 509
            :|:|.....:....:.:...|.:.:||......::.|:     ....:|.:....|.|..:..||
  Fly    72 KVLCTDWSPDKRHIISSSQDGRLIIWDAFTTNKEHAVT-----MPTTWIMACAYAPSGNFVACGG 131

  Fly   510 EASNLSIWDLASPTPRIKAELTSAAPACYALAISPDSKVCFSCC-------------SDGNIAVW 561
            ..:.::::.:.|.......:.|......|           .|||             .|...|:|
  Fly   132 LDNKVTVYPITSDEEMAAKKRTVGTHTSY-----------MSCCIYPNSDQQILTGSGDSTCALW 185

  Fly   562 DLHNEILVRQFQGHTDGASCIDISPD--GSRLWTGGLDNTVRSWDLREGRQLQQHD-FSSQIFSL 623
            |:.:..|::.|.||:.....||::|:  |:...:|..|.....||:|.|..:|..: ..|.:.|:
  Fly   186 DVESGQLLQSFHGHSGDVMAIDLAPNETGNTFVSGSCDRMAFIWDMRSGHVVQSFEGHQSDVNSV 250

  Fly   624 GYCPTGDWLAVGMENSHVEVLHASKPDKYQLHLHESCVL---SLRFAACGKWFVSTGKDNLLNAW 685
            .:.|.||.:|.|.::|...:.......:..:...||.:.   |:.|:..|:...:...|..:|.|
  Fly   251 KFHPCGDAIATGSDDSSCRLYDMRADREVAVFAKESIIFGVNSVDFSVSGRLLFAGYNDYTVNLW 315

  Fly   686 RTPYGASIFQSKETSSVLSC-DISTDDKYIVTGSGDKKATVY 726
            .|.....:.......:.:|| .:|.|...:.|||.|....|:
  Fly   316 DTLKSERVCLLYGHENKVSCVQVSPDGTALSTGSWDYTIRVW 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 62/302 (21%)
WD40 repeat 447..486 CDD:293791 5/38 (13%)
WD40 repeat 494..532 CDD:293791 5/37 (14%)
WD40 repeat 537..573 CDD:293791 9/48 (19%)
WD40 repeat 580..615 CDD:293791 11/36 (31%)
WD40 repeat 620..653 CDD:293791 7/32 (22%)
WD40 repeat 661..695 CDD:293791 7/36 (19%)
WD40 repeat 702..726 CDD:293791 8/24 (33%)
Gbeta5NP_572452.1 WD40 62..358 CDD:238121 62/302 (21%)
WD40 repeat 73..110 CDD:293791 6/41 (15%)
WD40 repeat 116..156 CDD:293791 6/39 (15%)
WD40 repeat 161..197 CDD:293791 8/35 (23%)
WD40 repeat 204..241 CDD:293791 11/36 (31%)
WD40 repeat 247..283 CDD:293791 7/35 (20%)
WD40 repeat 291..327 CDD:293791 7/35 (20%)
WD40 repeat 333..357 CDD:293791 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.