DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and CG2260

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_572441.1 Gene:CG2260 / 31732 FlyBaseID:FBgn0030000 Length:609 Species:Drosophila melanogaster


Alignment Length:163 Identity:39/163 - (23%)
Similarity:64/163 - (39%) Gaps:18/163 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   455 PTKYVYTGGKGCVKVWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDL 519
            ||.|. ...|..|..:|  :.|     ::|.|::|.|.:..:..||....|..|..|...|..|:
  Fly   226 PTMYA-VAQKSWVYFYD--KKG-----TELHCIKRLNRVNRLDFLPYHFLLAAGNSAGYASWLDV 282

  Fly   520 ASPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGN--IAVWDLHNEILVRQFQGHTDGASCI 582
            :  ...:.....:.......|..:|.:.|.  |...|.  :::|.......:.:...|:...|.:
  Fly   283 S--IGELVGNFNTGLGDIRMLRHNPRNGVL--CIGGGRGVVSMWSPKVREPLAKLLCHSTAMSAL 343

  Fly   583 DISPDGSRLWTGGLDNTVRSWDLREGRQLQQHD 615
            .:.|.|..|.|.|||..|:.||:|    :..||
  Fly   344 AVEPKGQYLVTAGLDRAVKVWDIR----MLVHD 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 39/163 (24%)
WD40 repeat 447..486 CDD:293791 8/30 (27%)
WD40 repeat 494..532 CDD:293791 7/37 (19%)
WD40 repeat 537..573 CDD:293791 6/37 (16%)
WD40 repeat 580..615 CDD:293791 12/34 (35%)
WD40 repeat 620..653 CDD:293791
WD40 repeat 661..695 CDD:293791
WD40 repeat 702..726 CDD:293791
CG2260NP_572441.1 WD40 177..398 CDD:295369 39/163 (24%)
WD40 <181..371 CDD:225201 37/160 (23%)
WD40 repeat 181..210 CDD:293791
WD40 repeat 218..253 CDD:293791 9/34 (26%)
WD40 repeat 256..292 CDD:293791 7/37 (19%)
WD40 repeat 299..334 CDD:293791 6/36 (17%)
WD40 repeat 340..376 CDD:293791 14/37 (38%)
BING4CT 422..500 CDD:198101
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.