DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and CG3071

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_569993.1 Gene:CG3071 / 31213 FlyBaseID:FBgn0023527 Length:535 Species:Drosophila melanogaster


Alignment Length:224 Identity:53/224 - (23%)
Similarity:97/224 - (43%) Gaps:21/224 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 GGKGCVKVWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPD-GRTLIVGGEASNLSIWDLASPTPR 525
            |....|::||::   |:..|...:....| |:|:..:.|. |...:.||....:.::|..:.| .
  Fly   142 GDDKSVRLWDVA---NEKVVQTYEDTHTD-YVRAGAMHPQAGHMFVSGGYDGKIKLYDTRAET-A 201

  Fly   526 IKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEI-LVRQFQGHTDGASCIDISPDGS 589
            ::..|...||. .::...|:..: |.......:.||||.:.. |:.....|....:|:.:..||.
  Fly   202 VQRTLDHGAPV-ESMLFLPNGSI-FVSAGGSQVRVWDLISGCRLLTMMSQHHKTVTCLRLGSDGR 264

  Fly   590 RLWTGGLDNTVRSWDLREGRQLQQHDFSSQIFSLGYCPTGDWLAVGMENSHVEV---LHASKPDK 651
            ||.:||||..|:.:|:...:.:....:.:.:.|:........:..||.:..|.:   :..|||. 
  Fly   265 RLLSGGLDRHVKIYDVSTYKTVHTLTYPNAVVSMAVADGDQAVVAGMVDGLVSIRRMMVDSKPS- 328

  Fly   652 YQLHLHESCVLSLRFAACGKWFVSTGKDN 680
               ||.:     :|.....|:||||.:.|
  Fly   329 ---HLKK-----IRADRARKYFVSTKRTN 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 53/224 (24%)
WD40 repeat 447..486 CDD:293791 6/23 (26%)
WD40 repeat 494..532 CDD:293791 8/38 (21%)
WD40 repeat 537..573 CDD:293791 7/36 (19%)
WD40 repeat 580..615 CDD:293791 11/34 (32%)
WD40 repeat 620..653 CDD:293791 7/35 (20%)
WD40 repeat 661..695 CDD:293791 7/20 (35%)
WD40 repeat 702..726 CDD:293791
CG3071NP_569993.1 WD40 <26..283 CDD:225201 37/147 (25%)
WD40 repeat 87..121 CDD:293791
WD40 89..318 CDD:238121 41/182 (23%)
WD40 repeat 126..162 CDD:293791 6/22 (27%)
WD40 repeat 170..206 CDD:293791 7/36 (19%)
WD40 repeat 212..247 CDD:293791 7/36 (19%)
WD40 repeat 254..288 CDD:293791 11/33 (33%)
WD40 repeat 295..318 CDD:293791 4/22 (18%)
UTP15_C 352..494 CDD:286472
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.