DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and Tle5

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:XP_038934511.1 Gene:Tle5 / 29466 RGDID:2731 Length:236 Species:Rattus norvegicus


Alignment Length:266 Identity:111/266 - (41%)
Similarity:138/266 - (51%) Gaps:68/266 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYPSPVRHPAA---------GGPP--------------PQGPIKFTIADTLERIKEEFNFLQAQY 42
            ::..|.|:|..         ||||              || .:|||.:|:.:|||:||..|||||
  Rat    16 LWLGPGRNPTGHSLWQGSFWGGPPLKSTPLRKQGSSHLPQ-QLKFTTSDSCDRIKDEFQLLQAQY 79

  Fly    43 HSIKLECEKLSNEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNTLINQLLPFLQADHQQQVL 107
            ||:||||:||::||:|||||||||||||||||:|||||.||.||||.:..|:||:|..:||||||
  Rat    80 HSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVL 144

  Fly   108 QAVERAKQVTMQELNLIIGHQQQHGIQQLLQQIHAQQVPGGPPQPMGALNPFGALGATMGLPHGP 172
            .|:|||||||..|||.||..|.|   ...|.|:.|..:| ..|.|:|...|        .||...
  Rat   145 GAIERAKQVTAPELNSIIRQQLQ---AHQLSQLQALALP-LTPLPVGLQPP--------SLPAVS 197

  Fly   173 QGLLNKPPEHHRPDIKPTGLEGPAAAEERLRNSVSPADREKYRTRSPLDIENDSKRRKDEKLQED 237
            .|               |||...:|...:...|                 :.|......:..|||
  Rat   198 AG---------------TGLLSLSALGSQTHLS-----------------KEDKNGHDGDTHQED 230

  Fly   238 EGEKSD 243
            :|||||
  Rat   231 DGEKSD 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828 79/135 (59%)
WD40 442..727 CDD:238121
WD40 repeat 447..486 CDD:293791
WD40 repeat 494..532 CDD:293791
WD40 repeat 537..573 CDD:293791
WD40 repeat 580..615 CDD:293791
WD40 repeat 620..653 CDD:293791
WD40 repeat 661..695 CDD:293791
WD40 repeat 702..726 CDD:293791
Tle5XP_038934511.1 TLE_N 50..171 CDD:397828 79/124 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.