| Sequence 1: | NP_996298.1 | Gene: | gro / 43162 | FlyBaseID: | FBgn0001139 | Length: | 730 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_758440.1 | Gene: | POC1B / 282809 | HGNCID: | 30836 | Length: | 478 | Species: | Homo sapiens |
| Alignment Length: | 259 | Identity: | 65/259 - (25%) |
|---|---|---|---|
| Similarity: | 112/259 - (43%) | Gaps: | 10/259 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 434 HARQINTLSHGEVVCAVTISNPTKYVYTGGKG-CVKVWDISQPGNKNPVSQLDCLQRDNYIRSVK 497
Fly 498 LLPDGRTLIVGGEASNLSIWDLASPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWD 562
Fly 563 LHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQHD-FSSQIFSLGYC 626
Fly 627 PTGDWLAVGMENSHVEVLHASKPDK-YQLHLHESCVLSLRFAACGKWFVSTGKDNLLNAWRTPY 689 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| gro | NP_996298.1 | TLE_N | 11..124 | CDD:397828 | |
| WD40 | 442..727 | CDD:238121 | 62/251 (25%) | ||
| WD40 repeat | 447..486 | CDD:293791 | 7/39 (18%) | ||
| WD40 repeat | 494..532 | CDD:293791 | 10/37 (27%) | ||
| WD40 repeat | 537..573 | CDD:293791 | 11/35 (31%) | ||
| WD40 repeat | 580..615 | CDD:293791 | 12/34 (35%) | ||
| WD40 repeat | 620..653 | CDD:293791 | 4/33 (12%) | ||
| WD40 repeat | 661..695 | CDD:293791 | 10/29 (34%) | ||
| WD40 repeat | 702..726 | CDD:293791 | |||
| POC1B | NP_758440.1 | WD40 | 10..298 | CDD:238121 | 62/254 (24%) |
| WD 1 | 16..55 | 3/4 (75%) | |||
| WD40 repeat | 21..58 | CDD:293791 | 3/7 (43%) | ||
| WD 2 | 58..99 | 9/43 (21%) | |||
| WD40 repeat | 63..100 | CDD:293791 | 7/39 (18%) | ||
| WD 3 | 101..139 | 9/39 (23%) | |||
| WD40 repeat | 106..142 | CDD:293791 | 10/37 (27%) | ||
| WD 4 | 142..181 | 11/38 (29%) | |||
| WD40 repeat | 147..182 | CDD:293791 | 11/34 (32%) | ||
| WD 5 | 183..223 | 12/39 (31%) | |||
| WD40 repeat | 190..225 | CDD:293791 | 12/34 (35%) | ||
| WD 6 | 226..265 | 5/38 (13%) | |||
| WD40 repeat | 231..267 | CDD:293791 | 5/35 (14%) | ||
| WD 7 | 268..307 | 11/34 (32%) | |||
| WD40 repeat | 273..299 | CDD:293791 | 8/25 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||