| Sequence 1: | NP_996298.1 | Gene: | gro / 43162 | FlyBaseID: | FBgn0001139 | Length: | 730 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_056241.3 | Gene: | POC1A / 25886 | HGNCID: | 24488 | Length: | 407 | Species: | Homo sapiens |
| Alignment Length: | 302 | Identity: | 67/302 - (22%) |
|---|---|---|---|
| Similarity: | 123/302 - (40%) | Gaps: | 53/302 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 431 IPRHARQINTLSHGEVVCAVTISNPTKYVYTGG-KGCVKVWDISQ-------PGNKNPVSQLDCL 487
Fly 488 ------------QRDN---------------------YIRSVKLLPDGRTLIVGGEASNLSIWDL 519
Fly 520 ASPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDI 584
Fly 585 SPDGSRLWTGGLDNTVRSWDLREGRQLQQHDF-SSQIFSLGYCPTGDWLAVGMENSHVEVLHASK 648
Fly 649 PD-KYQLHLHESCVLSLRFAACGKWFVSTGKDNLLNAWRTPY 689 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| gro | NP_996298.1 | TLE_N | 11..124 | CDD:397828 | |
| WD40 | 442..727 | CDD:238121 | 65/291 (22%) | ||
| WD40 repeat | 447..486 | CDD:293791 | 12/46 (26%) | ||
| WD40 repeat | 494..532 | CDD:293791 | 8/37 (22%) | ||
| WD40 repeat | 537..573 | CDD:293791 | 8/35 (23%) | ||
| WD40 repeat | 580..615 | CDD:293791 | 14/34 (41%) | ||
| WD40 repeat | 620..653 | CDD:293791 | 6/33 (18%) | ||
| WD40 repeat | 661..695 | CDD:293791 | 7/29 (24%) | ||
| WD40 repeat | 702..726 | CDD:293791 | |||
| POC1A | NP_056241.3 | WD40 | 11..299 | CDD:238121 | 66/297 (22%) |
| WD 1 | 17..56 | 10/38 (26%) | |||
| WD40 repeat | 23..59 | CDD:293791 | 8/35 (23%) | ||
| WD 2 | 59..98 | 6/41 (15%) | |||
| WD40 repeat | 64..100 | CDD:293791 | 4/38 (11%) | ||
| WD 3 | 101..140 | 7/40 (18%) | |||
| WD40 repeat | 107..140 | CDD:293791 | 7/34 (21%) | ||
| WD 4 | 143..182 | 8/38 (21%) | |||
| WD40 repeat | 148..184 | CDD:293791 | 8/35 (23%) | ||
| WD 5 | 185..224 | 14/38 (37%) | |||
| WD40 repeat | 190..226 | CDD:293791 | 14/35 (40%) | ||
| WD 6 | 227..266 | 7/38 (18%) | |||
| WD40 repeat | 232..255 | CDD:293791 | 5/22 (23%) | ||
| WD 7 | 269..308 | 8/34 (24%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||