DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and SPAC959.03c

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_594170.1 Gene:SPAC959.03c / 2543484 PomBaseID:SPAC959.03c Length:520 Species:Schizosaccharomyces pombe


Alignment Length:287 Identity:64/287 - (22%)
Similarity:104/287 - (36%) Gaps:75/287 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   457 KYVYTGGKGCVKVWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLAS 521
            ||||        |:|       |..:::.||:|...:.::..||....|...|.|..|...|:: 
pombe   163 KYVY--------VYD-------NMGTEIHCLKRHIEVNALDFLPYHLLLTSIGNAGYLKYQDVS- 211

  Fly   522 PTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISP 586
             |.::.||..:...|.:.|..:|.:.|.....::|.:.:|...:...:.:...|......:.::.
pombe   212 -TGQLVAEHRTGMGASHVLHQNPHNAVEHVGHANGQVTLWSPSSTTPLVKMLTHRGPVRDLAVNR 275

  Fly   587 DGSRLWTGGLDNTVRSWDLREGRQLQQHDFSSQIFSLGYCPT---------GDWLAVGMENSHV- 641
            ||..:.|.|.|:.::.||||..::|..:          |.||         ...||||. ..|. 
pombe   276 DGRYMVTAGADSLLKVWDLRTYKELHSY----------YTPTPAQRLTLSDRGLLAVGW-GPHAT 329

  Fly   642 ---EVLHASKPDKYQLH-LHESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYG--ASIFQSKETS 700
               :.|...:...|..| |..|.|:.|.:.                    ||.  ..|..:|...
pombe   330 IWKDALRTKQNFPYMNHLLPSSSVVDLHYC--------------------PYEDILGIGHAKGFE 374

  Fly   701 SVLSCDISTDDKYIVTGSGDKKATVYE 727
            |:           ||.|||:.....||
pombe   375 SI-----------IVPGSGEPNYDSYE 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 62/285 (22%)
WD40 repeat 447..486 CDD:293791 7/28 (25%)
WD40 repeat 494..532 CDD:293791 10/37 (27%)
WD40 repeat 537..573 CDD:293791 5/35 (14%)
WD40 repeat 580..615 CDD:293791 10/34 (29%)
WD40 repeat 620..653 CDD:293791 9/45 (20%)
WD40 repeat 661..695 CDD:293791 5/35 (14%)
WD40 repeat 702..726 CDD:293791 5/23 (22%)
SPAC959.03cNP_594170.1 WD40 105..>303 CDD:295369 37/156 (24%)
WD40 repeat 105..138 CDD:293791
WD40 <110..376 CDD:225201 56/260 (22%)
WD40 repeat 146..182 CDD:293791 10/33 (30%)
WD40 repeat 184..217 CDD:293791 8/34 (24%)
WD40 repeat 225..263 CDD:293791 6/37 (16%)
WD40 repeat 268..303 CDD:293791 10/34 (29%)
BING4CT 342..420 CDD:285375 18/80 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.