DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and cpc2

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_593770.1 Gene:cpc2 / 2543298 PomBaseID:SPAC6B12.15 Length:314 Species:Schizosaccharomyces pombe


Alignment Length:314 Identity:75/314 - (23%)
Similarity:121/314 - (38%) Gaps:52/314 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   409 HMNGEGSLQPVPFPPDAL------------------VGVGIPRHARQINTLSHGEVVCAVTISNP 455
            |.....||...|..||.|                  |..|:.:  |::...||....||::..:.
pombe    14 HSGWVTSLSTAPENPDILLSGSRDKSIILWNLVRDDVNYGVAQ--RRLTGHSHFVSDCALSFDSH 76

  Fly   456 TKYVYTGGKGCVKVWDISQPGNKNPVSQLDCLQR----DNYIRSVKLLPDGRTLIVGGEASNLSI 516
            .....:..| .:::||:.:.         :|..:    .:.:.||.:.||.|.::.|.....:.|
pombe    77 YALSASWDK-TIRLWDLEKG---------ECTHQFVGHTSDVLSVSISPDNRQVVSGSRDKTIKI 131

  Fly   517 WDLASPTPRIKAELTSAA----PACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTD 577
            |::..   ..|..:|...    .:|...:.:||:....|...|..:.||||....|.....|||.
pombe   132 WNIIG---NCKYTITDGGHSDWVSCVRFSPNPDNLTFVSAGWDKAVKVWDLETFSLRTSHYGHTG 193

  Fly   578 GASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQHDFSSQIFSLGYCPTGDWL--AVGMENSH 640
            ..|.:.||||||...:||.|.|:..|||.|...|...:..:.|.:|.:.|...||  |.|.....
pombe   194 YVSAVTISPDGSLCASGGRDGTLMLWDLNESTHLYSLEAKANINALVFSPNRYWLCAATGSSIRI 258

  Fly   641 VEVLHASKPDKYQLHL--------HESCVLSLRFAACGKWFVSTGKDNLLNAWR 686
            .::....|.|:..:..        ...|: ||.::..|:...|...|||:..|:
pombe   259 FDLETQEKVDELTVDFVGVGKKSSEPECI-SLTWSPDGQTLFSGWTDNLIRVWQ 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 65/263 (25%)
WD40 repeat 447..486 CDD:293791 5/38 (13%)
WD40 repeat 494..532 CDD:293791 9/37 (24%)
WD40 repeat 537..573 CDD:293791 10/35 (29%)
WD40 repeat 580..615 CDD:293791 16/34 (47%)
WD40 repeat 620..653 CDD:293791 9/34 (26%)
WD40 repeat 661..695 CDD:293791 8/26 (31%)
WD40 repeat 702..726 CDD:293791
cpc2NP_593770.1 WD40 7..311 CDD:238121 74/312 (24%)
WD40 <7..310 CDD:225201 74/311 (24%)
WD40 repeat 18..61 CDD:293791 9/44 (20%)
WD40 repeat 67..103 CDD:293791 6/45 (13%)
WD40 repeat 108..144 CDD:293791 9/38 (24%)
WD40 repeat 152..189 CDD:293791 10/36 (28%)
WD40 repeat 195..231 CDD:293791 16/35 (46%)
WD40 repeat 236..275 CDD:293791 9/38 (24%)
WD40 repeat 286..310 CDD:293791 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.