DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and wdr-5.2

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_510394.1 Gene:wdr-5.2 / 181540 WormBaseID:WBGene00010572 Length:395 Species:Caenorhabditis elegans


Alignment Length:487 Identity:103/487 - (21%)
Similarity:165/487 - (33%) Gaps:164/487 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 MEVRDRESLNGERLEKPSSSGIKQERPPSRSGSSSSRSTPSLKTKDMEKPGTPGAKARTPTPNAA 332
            ||.|.|.|.:.|:....:.:|                |.|||       |.:|......|:|...
 Worm     1 MEQRGRASQDEEQAIVGAETG----------------SQPSL-------PVSPMRPIIAPSPAMV 42

  Fly   333 APAPGVNPKQMMPQGPPPAGYPGAPYQRPADPYQRPPSDPAY-GRPPPMPYDPHAHVRTNGIPHP 396
            .|.||..      .|.|..|..|.|.|.........|. |:| ..|.||             |:|
 Worm    43 LPTPGHG------MGIPQFGPVGLPAQASTPMLSSTPG-PSYSSAPTPM-------------PNP 87

  Fly   397 SALTGGKPAYSFHMNGEGSLQPVPFPPDALVGVGIPRHARQINTLSHGEVVCAVTISNPTKYVYT 461
            ||..                   .:|...|| ..||.        :|.:.:..:..|...:|:.:
 Worm    88 SAAN-------------------LWPTYKLV-AEIPN--------AHKKSISGIKFSPDGRYMGS 124

  Fly   462 GGKGC-VKVWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLASPTPR 525
            |...| :|:|                  |.:::....|:  |..|.:     |...|        
 Worm   125 GSADCSIKIW------------------RMDFVYEKTLM--GHRLGI-----NEFSW-------- 156

  Fly   526 IKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSR 590
                             |.|||:..||..|..:.|:|:.:...|:..:|||:...|...:|.|:.
 Worm   157 -----------------SSDSKLIVSCSDDKLVKVFDVSSGRCVKTLKGHTNYVFCCCFNPSGTL 204

  Fly   591 LWTGGLDNTVRSWDLREGR---QLQQHDFSSQIFSLGYCPTGDWLAVGMENSHVEVLHASKPDKY 652
            :.:|..|.|:|.|..|.|.   .:..|:  ..:.|:.:...|.:||.|..:..|.:..::.    
 Worm   205 IASGSFDETIRIWCARNGNTIFSIPGHE--DPVSSVCFNRDGAYLASGSYDGIVRIWDSTT---- 263

  Fly   653 QLHLHESCVLSL-----------RFAACGKWFVSTGKDNLLNAW----------RTPYGASIFQS 696
                 .:||.:|           :|:..||:.:::..:|.|..|          .|.:..|.:..
 Worm   264 -----GTCVKTLIDEEHPPITHVKFSPNGKYILASNLNNTLKLWDYQKLRVLKEYTGHENSKYCV 323

  Fly   697 KETSSVLSCDISTDDKYIVTGSGDKKATVYEV 728
            ....||      |..|:||:||.|.|..::.:
 Worm   324 AANFSV------TGGKWIVSGSEDHKVYIWNL 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 64/309 (21%)
WD40 repeat 447..486 CDD:293791 6/39 (15%)
WD40 repeat 494..532 CDD:293791 5/37 (14%)
WD40 repeat 537..573 CDD:293791 10/35 (29%)
WD40 repeat 580..615 CDD:293791 10/37 (27%)
WD40 repeat 620..653 CDD:293791 6/32 (19%)
WD40 repeat 661..695 CDD:293791 10/54 (19%)
WD40 repeat 702..726 CDD:293791 9/23 (39%)
wdr-5.2NP_510394.1 WWbp <1..87 CDD:304964 31/128 (24%)
WD40 <104..395 CDD:225201 64/321 (20%)
WD40 106..392 CDD:238121 64/311 (21%)
WD40 repeat 110..146 CDD:293791 8/55 (15%)
WD40 repeat 152..188 CDD:293791 12/60 (20%)
WD40 repeat 193..229 CDD:293791 10/35 (29%)
WD40 repeat 236..271 CDD:293791 8/43 (19%)
WD40 repeat 278..314 CDD:293791 6/35 (17%)
WD40 repeat 322..359 CDD:293791 10/34 (29%)
WD40 repeat 365..391 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.