DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and B0280.9

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_498555.1 Gene:B0280.9 / 175994 WormBaseID:WBGene00015104 Length:429 Species:Caenorhabditis elegans


Alignment Length:257 Identity:48/257 - (18%)
Similarity:94/257 - (36%) Gaps:48/257 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 RPPPMPYDPHAHVRTNGIPHPS---ALTG-GKPAYSFHMNGEGSLQPVPFPPDALVGVGIPRHAR 436
            :||...  |...:|...|.|.|   |:.| ....|..|......:..:..|.:|......|.|:|
 Worm   204 KPPNTV--PKQGIRLFAISHDSQFLAIAGHNSHIYVLHATSMEHITTISLPANASEIKFFPSHSR 266

  Fly   437 QINTLSHGEVVCAVTISNPTKYVYTGGKGCVKVWDISQPGNKNPVSQLDCLQRDNYIRSVKLL-- 499
            :|      .::|..              |.:.:.:|..||.|   |.......|..:....|.  
 Worm   267 EI------WIICET--------------GQIVIANIGLPGTK---SSQHTFTDDGAVHGTTLAIS 308

  Fly   500 PDGRTLIVGGEASNLSIW---DLASPT-PRIKAELTSAAPACYALAISPDSKVCFSCCS--DGNI 558
            ..|.....|.:...::::   |..:.| ||....:::...|..::|.:.|:::...|.:  |.::
 Worm   309 QHGDYFATGSDTGIVNVYSGNDCRNSTNPRPLFNVSNLVTAVSSIAFNSDAQLMAICSNVKDNHL 373

  Fly   559 AVWDLHNEILVRQF---QGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQHDFS 617
            .:..:.::...:.|   .|....|.|::.||:|..:..|..|..:..:::        |.|:
 Worm   374 RLVHVASQTTFKNFPERNGKVTHARCVEFSPNGGYMAVGNDDGRLHVFEI--------HHFT 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 31/187 (17%)
WD40 repeat 447..486 CDD:293791 7/38 (18%)
WD40 repeat 494..532 CDD:293791 7/43 (16%)
WD40 repeat 537..573 CDD:293791 5/40 (13%)
WD40 repeat 580..615 CDD:293791 6/34 (18%)
WD40 repeat 620..653 CDD:293791
WD40 repeat 661..695 CDD:293791
WD40 repeat 702..726 CDD:293791
B0280.9NP_498555.1 WD40 <66..424 CDD:225201 46/252 (18%)
WD40 repeat 122..195 CDD:293791
WD40 167..423 CDD:295369 46/243 (19%)
WD40 repeat 168..207 CDD:293791 1/2 (50%)
WD40 repeat 201..251 CDD:293791 11/48 (23%)
WD40 repeat 258..296 CDD:293791 11/60 (18%)
WD40 repeat 303..343 CDD:293791 7/39 (18%)
WD40 repeat 350..388 CDD:293791 4/37 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.