DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and wdr-48

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001129837.1 Gene:wdr-48 / 175600 WormBaseID:WBGene00009441 Length:697 Species:Caenorhabditis elegans


Alignment Length:310 Identity:67/310 - (21%)
Similarity:128/310 - (41%) Gaps:52/310 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 VRTNGIPHPSALTGGKPAYSFH--MNGEGSLQPVPFPPDALVGVGIPRHARQINTL---SHGEVV 447
            :||..:||      .|.|:|..  :...|...||.:..      .:.:|...:|.:   .||:::
 Worm    53 IRTWSVPH------HKDAFSARGGVRSPGKNSPVQYQG------SLEQHTDWVNDMILCGHGKIL 105

  Fly   448 CAVTISNPTKYVYTGGKGCVKVWDISQPGNKNPVSQLDCLQ-RDNYIRSVKLLPDGRTLIVGGEA 511
              ::.||.|         .||||:|.: .||:  ..:||:: ..:|:..:...|.....:.....
 Worm   106 --ISASNDT---------TVKVWNIER-DNKH--GFIDCIRTHKDYVSCLAYAPIVEKAVSASFD 156

  Fly   512 SNLSIWDLASPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHT 576
            .|:.::|:.:....:. .|.....:.|:||.:|:..:.....::..|.::|......:.:.:|||
 Worm   157 HNIFVYDINANFKTVN-NLIGCKDSIYSLATTPNLSLVLGAGTEKCIRLFDPRTNEKIMKLRGHT 220

  Fly   577 DGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQHDFSSQIFSLGYC---PTGDWLAVGMEN 638
            |....:.::.||:|..:.|.|.|:|.||:.:.|            .:..|   ..|.| .:.:::
 Worm   221 DNVRALVVNDDGTRALSAGSDATIRLWDIGQQR------------CIATCIAHEEGVW-TLQVDS 272

  Fly   639 SHVEVLHASKPD---KYQLHLHESCVLSLRFAACGKWFVSTGKDNLLNAW 685
            |...|..|.|..   |..|:......|..:..|..|..:.:.|||.::.|
 Worm   273 SFTTVYSAGKDKMVVKTPLYDFTKSQLLFKEEAPVKKLLLSEKDNPVSLW 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 55/251 (22%)
WD40 repeat 447..486 CDD:293791 10/38 (26%)
WD40 repeat 494..532 CDD:293791 4/37 (11%)
WD40 repeat 537..573 CDD:293791 6/35 (17%)
WD40 repeat 580..615 CDD:293791 10/34 (29%)
WD40 repeat 620..653 CDD:293791 8/38 (21%)
WD40 repeat 661..695 CDD:293791 7/25 (28%)
WD40 repeat 702..726 CDD:293791
wdr-48NP_001129837.1 WD40 2..376 CDD:225201 67/310 (22%)
WD40 29..322 CDD:238121 66/308 (21%)
WD40 repeat 32..88 CDD:293791 10/46 (22%)
WD40 repeat 94..133 CDD:293791 15/52 (29%)
WD40 repeat 138..175 CDD:293791 3/37 (8%)
WD40 repeat 182..217 CDD:293791 6/34 (18%)
WD40 repeat 223..259 CDD:293791 10/47 (21%)
WD40 repeat 307..333 CDD:293791 5/16 (31%)
DUF3337 530..695 CDD:288649
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.