DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and wdr-83

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_494926.1 Gene:wdr-83 / 173867 WormBaseID:WBGene00018014 Length:305 Species:Caenorhabditis elegans


Alignment Length:288 Identity:58/288 - (20%)
Similarity:98/288 - (34%) Gaps:85/288 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 LDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIW-------------------DLASPTPRIKAE 529
            :||.|  ..:|:|:...||...:..|....:.:|                   |.||.:...:..
 Worm    12 IDCKQ--GAVRAVRYNVDGNYCVTCGSDKTVKLWNPLKSSLLKTYSGTGNEVLDAASSSDNSQIA 74

  Fly   530 LTSAAPAC---------------------YALAISPDSKVCFSCCSDGNIAVWDL--HNEILVRQ 571
            ...|..||                     .|:|.:.:|.|.||...|..:..:|.  .:|..::.
 Worm    75 AGGADRACTVFDVETGKQLRRWRTHGAQVNAVAFNEESSVVFSGSMDCTMQAFDCRSRSEKPIQI 139

  Fly   572 FQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQHDFSSQIFSLGYCPTGDWLAVGM 636
            |...|||...||:  :|..:..|..|...|.:.:|:|.....: ....:.|:.:.|..:.|..|:
 Worm   140 FNESTDGILSIDV--NGHEIVAGSADGNYRVYSIRDGNMTVDY-MGDSVNSVSFTPDSNCLLAGV 201

  Fly   637 ENSHVEVLHASKPDKYQLHLHESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKETSS 701
            ....|.::     ||                       |:||  ||        ||....:.|..
 Worm   202 MGGIVRLI-----DK-----------------------SSGK--LL--------ASYKGHQNTEY 228

  Fly   702 VLSCDISTDDKYIVTGSGDKKATVYEVI 729
            .|.|.:....:::.:||.|....||.::
 Worm   229 KLDCRVLQSIEHVASGSEDGFVYVYSLL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 57/284 (20%)
WD40 repeat 447..486 CDD:293791 0/1 (0%)
WD40 repeat 494..532 CDD:293791 9/56 (16%)
WD40 repeat 537..573 CDD:293791 10/58 (17%)
WD40 repeat 580..615 CDD:293791 8/34 (24%)
WD40 repeat 620..653 CDD:293791 7/32 (22%)
WD40 repeat 661..695 CDD:293791 7/33 (21%)
WD40 repeat 702..726 CDD:293791 5/23 (22%)
wdr-83NP_494926.1 WD40 10..294 CDD:238121 58/288 (20%)
WD40 repeat 21..56 CDD:293791 5/34 (15%)
WD40 repeat 62..98 CDD:293791 6/35 (17%)
WD40 repeat 103..141 CDD:293791 9/37 (24%)
WD40 repeat 148..180 CDD:293791 8/33 (24%)
WD40 repeat 185..221 CDD:293791 14/73 (19%)
WD40 repeat 229..265 CDD:293791 7/28 (25%)
WD40 repeat 271..294 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.